Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3AIG7

Protein Details
Accession A0A0C3AIG7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-67LLRPRGLKKEKKFKRSILPWHSSHydrophilic
NLS Segment(s)
PositionSequence
48-59PRGLKKEKKFKR
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MNSYSPRIRQSNITPFLHSNYLKHELCGACIYKLHLLPPYTALVLLRPRGLKKEKKFKRSILPWHSSDPVDQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.48
4 0.48
5 0.4
6 0.3
7 0.29
8 0.35
9 0.31
10 0.3
11 0.32
12 0.25
13 0.26
14 0.28
15 0.23
16 0.16
17 0.17
18 0.18
19 0.15
20 0.15
21 0.15
22 0.15
23 0.15
24 0.15
25 0.16
26 0.15
27 0.13
28 0.12
29 0.11
30 0.11
31 0.13
32 0.13
33 0.14
34 0.16
35 0.17
36 0.24
37 0.33
38 0.4
39 0.47
40 0.57
41 0.64
42 0.72
43 0.78
44 0.79
45 0.81
46 0.81
47 0.82
48 0.81
49 0.79
50 0.72
51 0.7
52 0.66
53 0.56