Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D412

Protein Details
Accession A0A0C3D412    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23ETLKRKPRDPPKTMSAKRRKIBasic
NLS Segment(s)
PositionSequence
6-22KRKPRDPPKTMSAKRRK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MPETLKRKPRDPPKTMSAKRRKIGAGADLPCTSAQLPKTSSRPNLTLSDWITVYSYADSHPDCTQADIVQHFSTLATGALIFDQSTLSCKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.81
4 0.8
5 0.79
6 0.76
7 0.74
8 0.66
9 0.58
10 0.54
11 0.5
12 0.47
13 0.4
14 0.4
15 0.34
16 0.33
17 0.29
18 0.26
19 0.19
20 0.14
21 0.13
22 0.13
23 0.16
24 0.19
25 0.24
26 0.27
27 0.31
28 0.31
29 0.32
30 0.32
31 0.32
32 0.3
33 0.29
34 0.25
35 0.23
36 0.19
37 0.18
38 0.15
39 0.12
40 0.12
41 0.08
42 0.07
43 0.06
44 0.08
45 0.08
46 0.1
47 0.11
48 0.13
49 0.12
50 0.14
51 0.14
52 0.13
53 0.15
54 0.14
55 0.17
56 0.15
57 0.15
58 0.13
59 0.12
60 0.12
61 0.1
62 0.08
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.05
70 0.06
71 0.06