Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZL47

Protein Details
Accession A0A0C2ZL47    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66TPAVARKTSRRHNHISKFVIHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 15, cyto_mito 5.333, cyto 5, mito 4.5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MDSTLEGLHARYGEGMVSCCITPLKGSIGRFVFGTKAFVISHSIRGTPAVARKTSRRHNHISKFVISFCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.1
5 0.09
6 0.1
7 0.1
8 0.09
9 0.08
10 0.08
11 0.13
12 0.15
13 0.16
14 0.21
15 0.21
16 0.22
17 0.21
18 0.2
19 0.17
20 0.14
21 0.15
22 0.09
23 0.1
24 0.09
25 0.1
26 0.14
27 0.13
28 0.17
29 0.16
30 0.16
31 0.15
32 0.16
33 0.16
34 0.15
35 0.2
36 0.2
37 0.22
38 0.25
39 0.32
40 0.4
41 0.49
42 0.56
43 0.58
44 0.64
45 0.72
46 0.78
47 0.81
48 0.77
49 0.73
50 0.66