Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EI66

Protein Details
Accession A0A0C3EI66    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-71TPPPPLPRPPPPKKSKKQIQMEERIEHydrophilic
NLS Segment(s)
PositionSequence
44-62RRTPPPPLPRPPPPKKSKK
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSELIRRVNSQPSSPFPNTHKPYSPLLKSSRTMLSRIAPLHLNRRTPPPPLPRPPPPKKSKKQIQMEERIEEELAETVEGWSCMAEEERRQMLRARIDAELGYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.45
4 0.53
5 0.53
6 0.54
7 0.54
8 0.49
9 0.54
10 0.57
11 0.54
12 0.5
13 0.5
14 0.49
15 0.45
16 0.45
17 0.45
18 0.38
19 0.36
20 0.32
21 0.3
22 0.29
23 0.29
24 0.27
25 0.23
26 0.24
27 0.31
28 0.33
29 0.33
30 0.3
31 0.37
32 0.37
33 0.37
34 0.43
35 0.43
36 0.48
37 0.51
38 0.56
39 0.59
40 0.67
41 0.72
42 0.74
43 0.74
44 0.76
45 0.78
46 0.82
47 0.82
48 0.81
49 0.83
50 0.83
51 0.82
52 0.82
53 0.78
54 0.69
55 0.61
56 0.52
57 0.42
58 0.32
59 0.23
60 0.13
61 0.09
62 0.07
63 0.06
64 0.05
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.08
72 0.1
73 0.12
74 0.18
75 0.23
76 0.24
77 0.26
78 0.3
79 0.35
80 0.4
81 0.41
82 0.39
83 0.34
84 0.35