Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D3N1

Protein Details
Accession A0A0C3D3N1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-80QCPIQSRSCCHPKPCRSNGRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MTAKTVQIVCVVRKGHPHTPKIVPTKLYRAEAMGWTLVPLLAITAAPEISPRASPHTSMQCPIQSRSCCHPKPCRSNGRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.48
4 0.5
5 0.5
6 0.55
7 0.61
8 0.6
9 0.57
10 0.52
11 0.48
12 0.53
13 0.51
14 0.46
15 0.38
16 0.33
17 0.3
18 0.27
19 0.24
20 0.16
21 0.12
22 0.1
23 0.09
24 0.07
25 0.06
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.07
38 0.08
39 0.13
40 0.14
41 0.16
42 0.22
43 0.3
44 0.31
45 0.31
46 0.34
47 0.33
48 0.36
49 0.37
50 0.4
51 0.35
52 0.38
53 0.45
54 0.52
55 0.52
56 0.58
57 0.65
58 0.68
59 0.75
60 0.81
61 0.83