Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2ZLL8

Protein Details
Accession A0A0C2ZLL8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-42GLERIRRLRRWLRRYCCFESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 8.5, cyto_mito 6.5, mito 3.5, plas 1, extr 1, pero 1, golg 1, cysk 1
Family & Domain DBs
Amino Acid Sequences MRFQDFKIESLLFGIDLSLPRDGLERIRRLRRWLRRYCCFESFRLDFAIASRSIPTTSGLTLHNCHKCFDHTQYLYTSSNRLRMSRVPLSTFASEPHLSIRCVFSYSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.09
4 0.1
5 0.1
6 0.09
7 0.09
8 0.11
9 0.12
10 0.17
11 0.24
12 0.3
13 0.37
14 0.46
15 0.49
16 0.56
17 0.65
18 0.68
19 0.71
20 0.74
21 0.75
22 0.76
23 0.82
24 0.79
25 0.77
26 0.69
27 0.6
28 0.57
29 0.5
30 0.42
31 0.34
32 0.28
33 0.2
34 0.18
35 0.19
36 0.12
37 0.1
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.08
44 0.08
45 0.09
46 0.1
47 0.11
48 0.13
49 0.2
50 0.24
51 0.24
52 0.25
53 0.25
54 0.27
55 0.3
56 0.33
57 0.36
58 0.31
59 0.33
60 0.34
61 0.37
62 0.35
63 0.32
64 0.31
65 0.23
66 0.29
67 0.29
68 0.28
69 0.28
70 0.3
71 0.37
72 0.4
73 0.41
74 0.38
75 0.39
76 0.42
77 0.41
78 0.37
79 0.3
80 0.29
81 0.26
82 0.23
83 0.26
84 0.24
85 0.23
86 0.24
87 0.26
88 0.21