Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Z3X6

Protein Details
Accession A0A0C2Z3X6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-142TPTPPPGVPKHPPRKRKGILBasic
NLS Segment(s)
PositionSequence
131-139PKHPPRKRK
Subcellular Location(s) nucl 9, extr 7, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MASEWDDSTGGRGDRGSPCVRLCLLAFYGDDLRPRQRWTRGSAAPKKGHRVDHTAGNGTRSGNCTGHRETKWHTSPDEMTSCRAAPHRTAPGQRSPTGRAYSRWFRDRPAAHHIPVEIYCIPTPTPPPGVPKHPPRKRKGILPYQGPDDTDETLRSTRLKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.28
4 0.28
5 0.28
6 0.31
7 0.31
8 0.28
9 0.25
10 0.23
11 0.21
12 0.19
13 0.18
14 0.17
15 0.2
16 0.19
17 0.21
18 0.2
19 0.25
20 0.25
21 0.3
22 0.34
23 0.39
24 0.42
25 0.45
26 0.51
27 0.53
28 0.61
29 0.66
30 0.68
31 0.68
32 0.68
33 0.7
34 0.66
35 0.64
36 0.57
37 0.56
38 0.49
39 0.49
40 0.48
41 0.45
42 0.41
43 0.36
44 0.33
45 0.27
46 0.25
47 0.2
48 0.2
49 0.17
50 0.18
51 0.21
52 0.24
53 0.3
54 0.3
55 0.3
56 0.31
57 0.39
58 0.42
59 0.39
60 0.36
61 0.31
62 0.32
63 0.33
64 0.33
65 0.24
66 0.21
67 0.2
68 0.2
69 0.18
70 0.19
71 0.16
72 0.14
73 0.18
74 0.22
75 0.25
76 0.29
77 0.31
78 0.36
79 0.39
80 0.4
81 0.39
82 0.37
83 0.38
84 0.38
85 0.36
86 0.31
87 0.35
88 0.4
89 0.43
90 0.47
91 0.42
92 0.41
93 0.48
94 0.49
95 0.47
96 0.48
97 0.46
98 0.4
99 0.41
100 0.38
101 0.32
102 0.29
103 0.28
104 0.19
105 0.17
106 0.16
107 0.15
108 0.15
109 0.14
110 0.16
111 0.16
112 0.2
113 0.19
114 0.26
115 0.29
116 0.37
117 0.43
118 0.52
119 0.6
120 0.65
121 0.73
122 0.74
123 0.8
124 0.79
125 0.8
126 0.79
127 0.79
128 0.79
129 0.78
130 0.75
131 0.7
132 0.66
133 0.57
134 0.49
135 0.41
136 0.35
137 0.27
138 0.24
139 0.21
140 0.21
141 0.22
142 0.25