Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YG17

Protein Details
Accession A0A0F4YG17   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-110ISAGCTTRIRRRRARRIRSSSCVCGRRRTRSCRDRWRRWVSLIHydrophilic
NLS Segment(s)
PositionSequence
77-84RRRRARRI
Subcellular Location(s) nucl 15, cyto 4, extr 4, mito 2, plas 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTDNANADMYVYAVAASASPAASQTSAACTTRWSVSISASPTTRSSTSTARSDGRSGRRSSTPCRARISAGCTTRIRRRRARRIRSSSCVCGRRRTRSCRDRWRRWVSLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.07
11 0.07
12 0.1
13 0.13
14 0.13
15 0.13
16 0.13
17 0.15
18 0.16
19 0.17
20 0.15
21 0.13
22 0.15
23 0.18
24 0.19
25 0.19
26 0.19
27 0.19
28 0.18
29 0.2
30 0.19
31 0.17
32 0.18
33 0.19
34 0.22
35 0.23
36 0.25
37 0.24
38 0.25
39 0.26
40 0.29
41 0.32
42 0.33
43 0.32
44 0.33
45 0.36
46 0.38
47 0.41
48 0.46
49 0.45
50 0.45
51 0.48
52 0.46
53 0.44
54 0.44
55 0.44
56 0.41
57 0.37
58 0.37
59 0.35
60 0.39
61 0.46
62 0.5
63 0.53
64 0.55
65 0.64
66 0.7
67 0.79
68 0.84
69 0.86
70 0.89
71 0.9
72 0.89
73 0.85
74 0.82
75 0.8
76 0.77
77 0.69
78 0.69
79 0.68
80 0.7
81 0.73
82 0.74
83 0.76
84 0.78
85 0.86
86 0.87
87 0.9
88 0.9
89 0.92
90 0.92