Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YG66

Protein Details
Accession A0A0F4YG66    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-112APATRRWRCRLRVLGRHRKRHDIVBasic
NLS Segment(s)
PositionSequence
52-108KAPPRRGRRGHRTMACVGTHRRRRREMAPIRASILRPAPATRRWRCRLRVLGRHRKR
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences GLPRPTLRWRCLHRSQARFDGTPGMVRTCSLDRTGDRRCLQPDQTYAGGLGKAPPRRGRRGHRTMACVGTHRRRRREMAPIRASILRPAPATRRWRCRLRVLGRHRKRHDIVMSGIAASCPFAFCPRWTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.76
4 0.73
5 0.65
6 0.57
7 0.53
8 0.44
9 0.4
10 0.35
11 0.28
12 0.23
13 0.22
14 0.24
15 0.2
16 0.2
17 0.17
18 0.19
19 0.2
20 0.27
21 0.32
22 0.37
23 0.37
24 0.39
25 0.42
26 0.43
27 0.44
28 0.42
29 0.39
30 0.35
31 0.34
32 0.3
33 0.26
34 0.22
35 0.18
36 0.13
37 0.14
38 0.15
39 0.17
40 0.2
41 0.28
42 0.32
43 0.39
44 0.47
45 0.53
46 0.59
47 0.64
48 0.69
49 0.66
50 0.65
51 0.61
52 0.56
53 0.48
54 0.41
55 0.38
56 0.38
57 0.43
58 0.46
59 0.49
60 0.5
61 0.54
62 0.56
63 0.62
64 0.62
65 0.63
66 0.62
67 0.57
68 0.55
69 0.53
70 0.48
71 0.4
72 0.33
73 0.25
74 0.2
75 0.21
76 0.22
77 0.27
78 0.37
79 0.42
80 0.5
81 0.54
82 0.62
83 0.65
84 0.7
85 0.73
86 0.74
87 0.76
88 0.77
89 0.82
90 0.83
91 0.89
92 0.84
93 0.83
94 0.76
95 0.75
96 0.7
97 0.63
98 0.57
99 0.52
100 0.47
101 0.38
102 0.35
103 0.26
104 0.2
105 0.16
106 0.12
107 0.08
108 0.08
109 0.11
110 0.14