Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4Z5T7

Protein Details
Accession A0A0F4Z5T7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
225-263VVHARARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEKPABasic
NLS Segment(s)
PositionSequence
229-261RARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEK
Subcellular Location(s) cyto_mito 10.833, mito 10, cyto 9.5, cyto_nucl 8.166, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
IPR044076  Ribosomal_P2  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002182  P:cytoplasmic translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
CDD cd05833  Ribosomal_P2  
Amino Acid Sequences MKHLAAYLLLGLAGNTSPSADDIKGVLGSVGIDADEERLEKLISELEGKDIQELIAEGTTKLASVPAGGAAAAPAAAGGAAAGGAAPAAEEKKEEKKEEEESDEDMGFVTIMHLSYMLDTSTDRSFFFPLFFETERCSPPLKLEAQNKNRLDEGFSDRHDNHLLSLFDFSFEKRPEEPSATMADIEYNAEEAAELKKKRQFRKFAYRGIELDQLLDLSSEQLRDVVHARARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEKPALVKTHLRDMIIVPEMIGSVIGIYSGKEFNQVEIKPEMVGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.06
5 0.07
6 0.1
7 0.1
8 0.11
9 0.11
10 0.13
11 0.12
12 0.12
13 0.11
14 0.08
15 0.08
16 0.07
17 0.07
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.1
31 0.13
32 0.13
33 0.16
34 0.18
35 0.18
36 0.18
37 0.16
38 0.15
39 0.12
40 0.12
41 0.1
42 0.09
43 0.09
44 0.08
45 0.09
46 0.09
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.04
76 0.04
77 0.06
78 0.09
79 0.18
80 0.23
81 0.26
82 0.28
83 0.32
84 0.38
85 0.41
86 0.43
87 0.36
88 0.33
89 0.33
90 0.29
91 0.25
92 0.19
93 0.15
94 0.1
95 0.08
96 0.06
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.07
108 0.09
109 0.09
110 0.1
111 0.11
112 0.12
113 0.12
114 0.12
115 0.11
116 0.11
117 0.14
118 0.14
119 0.14
120 0.16
121 0.18
122 0.19
123 0.2
124 0.2
125 0.17
126 0.18
127 0.22
128 0.23
129 0.27
130 0.35
131 0.44
132 0.48
133 0.57
134 0.56
135 0.53
136 0.5
137 0.43
138 0.35
139 0.29
140 0.29
141 0.23
142 0.23
143 0.26
144 0.25
145 0.27
146 0.26
147 0.22
148 0.17
149 0.18
150 0.17
151 0.13
152 0.14
153 0.12
154 0.11
155 0.11
156 0.11
157 0.12
158 0.13
159 0.15
160 0.14
161 0.18
162 0.19
163 0.23
164 0.23
165 0.19
166 0.21
167 0.19
168 0.18
169 0.14
170 0.12
171 0.09
172 0.08
173 0.06
174 0.05
175 0.04
176 0.04
177 0.04
178 0.04
179 0.07
180 0.12
181 0.13
182 0.16
183 0.21
184 0.29
185 0.38
186 0.46
187 0.53
188 0.56
189 0.67
190 0.71
191 0.74
192 0.73
193 0.68
194 0.6
195 0.54
196 0.49
197 0.37
198 0.31
199 0.23
200 0.17
201 0.13
202 0.12
203 0.08
204 0.06
205 0.06
206 0.06
207 0.06
208 0.07
209 0.06
210 0.08
211 0.1
212 0.13
213 0.17
214 0.22
215 0.27
216 0.34
217 0.43
218 0.47
219 0.53
220 0.58
221 0.64
222 0.7
223 0.76
224 0.79
225 0.81
226 0.8
227 0.76
228 0.72
229 0.72
230 0.69
231 0.68
232 0.68
233 0.67
234 0.71
235 0.76
236 0.76
237 0.74
238 0.74
239 0.75
240 0.73
241 0.75
242 0.76
243 0.78
244 0.81
245 0.79
246 0.75
247 0.67
248 0.6
249 0.53
250 0.52
251 0.46
252 0.43
253 0.4
254 0.44
255 0.44
256 0.43
257 0.39
258 0.32
259 0.33
260 0.29
261 0.26
262 0.16
263 0.14
264 0.14
265 0.12
266 0.11
267 0.05
268 0.03
269 0.03
270 0.04
271 0.04
272 0.04
273 0.06
274 0.07
275 0.08
276 0.13
277 0.14
278 0.16
279 0.24
280 0.24
281 0.26
282 0.27
283 0.28
284 0.23
285 0.23
286 0.22
287 0.16
288 0.16
289 0.12
290 0.11
291 0.11
292 0.1
293 0.11
294 0.09
295 0.09
296 0.13
297 0.15
298 0.15
299 0.17
300 0.24
301 0.31
302 0.36
303 0.43
304 0.47
305 0.51
306 0.57
307 0.58
308 0.57
309 0.54
310 0.53
311 0.49
312 0.45
313 0.4
314 0.33