Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YSN3

Protein Details
Accession A0A0F4YSN3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTRKTKSRGVEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTRKTKSRGVEKKKKDPNAPKR
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKTKSRGVEKKKKDPNAPKRGLSAYMFFANEQREAVREQNPGISFGQVGKILGERWKALSDEERRPYEEKAQADKKRYEDEKASYNVGETLPGGQAQALY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.88
4 0.89
5 0.91
6 0.89
7 0.88
8 0.88
9 0.88
10 0.88
11 0.85
12 0.77
13 0.72
14 0.65
15 0.58
16 0.49
17 0.4
18 0.32
19 0.28
20 0.25
21 0.21
22 0.21
23 0.19
24 0.17
25 0.15
26 0.12
27 0.11
28 0.13
29 0.15
30 0.17
31 0.16
32 0.16
33 0.2
34 0.2
35 0.21
36 0.19
37 0.16
38 0.13
39 0.12
40 0.13
41 0.09
42 0.08
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.2
54 0.24
55 0.31
56 0.36
57 0.37
58 0.38
59 0.4
60 0.41
61 0.41
62 0.41
63 0.37
64 0.41
65 0.49
66 0.52
67 0.56
68 0.58
69 0.55
70 0.58
71 0.56
72 0.53
73 0.49
74 0.48
75 0.48
76 0.47
77 0.45
78 0.36
79 0.34
80 0.3
81 0.24
82 0.2
83 0.14
84 0.13
85 0.11
86 0.11
87 0.1