Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YYV7

Protein Details
Accession A0A0F4YYV7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-142AEKEEYLKQKRREERRIREEKKAAEBasic
NLS Segment(s)
PositionSequence
125-150KQKRREERRIREEKKAAEKREKKERE
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYYFTSNVVSPPATIYVGKDKYENNESWENIPKELLEDCAQLTKANSIEGNHGNKKDNITVIYTPWSNLMKDGSMATGQVSFHNPKLTKRIFVPTRQNHIVNRLNKTRVEKFPDLMAEKEEYLKQKRREERRIREEKKAAEKREKKEREQLKWQKEHAYDDLMSEENIQQSSNQDRDPNFLDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.24
5 0.27
6 0.27
7 0.28
8 0.28
9 0.33
10 0.39
11 0.37
12 0.34
13 0.36
14 0.37
15 0.38
16 0.45
17 0.4
18 0.35
19 0.34
20 0.28
21 0.24
22 0.23
23 0.22
24 0.14
25 0.14
26 0.14
27 0.16
28 0.16
29 0.15
30 0.15
31 0.15
32 0.14
33 0.14
34 0.15
35 0.13
36 0.18
37 0.23
38 0.29
39 0.31
40 0.33
41 0.34
42 0.35
43 0.36
44 0.34
45 0.3
46 0.24
47 0.24
48 0.22
49 0.2
50 0.22
51 0.19
52 0.17
53 0.18
54 0.18
55 0.14
56 0.14
57 0.14
58 0.11
59 0.11
60 0.11
61 0.09
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.08
68 0.11
69 0.11
70 0.12
71 0.18
72 0.18
73 0.19
74 0.27
75 0.27
76 0.26
77 0.27
78 0.35
79 0.32
80 0.38
81 0.47
82 0.45
83 0.51
84 0.52
85 0.52
86 0.44
87 0.49
88 0.49
89 0.43
90 0.44
91 0.41
92 0.4
93 0.41
94 0.46
95 0.45
96 0.43
97 0.47
98 0.43
99 0.39
100 0.39
101 0.4
102 0.36
103 0.3
104 0.26
105 0.19
106 0.18
107 0.19
108 0.19
109 0.2
110 0.25
111 0.33
112 0.38
113 0.46
114 0.55
115 0.63
116 0.72
117 0.77
118 0.81
119 0.84
120 0.88
121 0.84
122 0.85
123 0.82
124 0.78
125 0.78
126 0.76
127 0.73
128 0.73
129 0.76
130 0.74
131 0.79
132 0.78
133 0.73
134 0.74
135 0.76
136 0.74
137 0.76
138 0.79
139 0.78
140 0.79
141 0.77
142 0.75
143 0.68
144 0.65
145 0.57
146 0.52
147 0.41
148 0.35
149 0.33
150 0.26
151 0.23
152 0.19
153 0.18
154 0.14
155 0.14
156 0.14
157 0.12
158 0.16
159 0.22
160 0.24
161 0.25
162 0.29
163 0.29
164 0.35
165 0.38
166 0.38