FuNGI

A0A0F4YUY7

Protein Details

Accession

A0A0F4YUY7

Localization Confidence

High

Confidence Score

16.5

NoLS Segment(s)

Position	Sequence	Protein Nature
1-25	MAQDKAEKKRKRDSDRHEWPSKKPA	Basic

NLS Segment(s)

Position	Sequence
8-14	KKRKRDS
467-467	K
469-498	EAASRRIARLRLPLQFPKVSRGGGGGGGRR

Subcellular Location(s)

nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR009668 RNA_pol-assoc_fac_A49-like
Gene Ontology	GO:0000428 C:DNA-directed RNA polymerase complex GO:0005730 C:nucleolus GO:0003677 F:DNA binding GO:0003899 F:DNA-directed 5'-3' RNA polymerase activity GO:0006351 P:DNA-templated transcription
Pfam	View protein in Pfam PF06870 RNA_pol_I_A49

Amino Acid Sequences

MAQDKAEKKRKRDSDRHEWPSKKPALEPQNLPPLAASVVEDDSELAPVLVNTPGLQCPKKLNLHPYLKPRNSGSLSSSGRNKGIVSTELLLQSSEHPKLDFLGREADDDADSQLKHYIAVVDPERKTWQFVEVRKMTLRGSVRRLKRDKDADEDAVSEQEEKEEDGATTSIREQRNDLTYTFGTKASRKAAQSIAENALLSNAPAGAANAAESAILSSIPAEAIEEASTKKETLQAEIQAAKPVPTANTSASHPSDVYPIDVLVPNGLSTLRQLPVKDWQDAVEAGNAITTTSRYVAHRVEAVVKSGNTTQLQILRFILILLEFARGLRRGKPTDPPGSKRLPPREDLRRILSSSPSSSSQLSDPVIDTIRRKFAPQGTVVSRTDVTFLHTTICALSLHIPPTPARDGGSSSLGGNAPNELATDPADLRDDLRLDNPTIMQYFRELGCRIDKPRETEFAKWGIKGGKVEAASRRIARLRLPLQFPKVSRGGGGGGGRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.85
2	0.88
3	0.91
4	0.9
5	0.85
6	0.8
7	0.8
8	0.77
9	0.69
10	0.63
11	0.63
12	0.63
13	0.66
14	0.64
15	0.62
16	0.65
17	0.61
18	0.57
19	0.47
20	0.38
21	0.31
22	0.26
23	0.19
24	0.11
25	0.12
26	0.12
27	0.12
28	0.11
29	0.11
30	0.11
31	0.1
32	0.07
33	0.07
34	0.06
35	0.08
36	0.07
37	0.07
38	0.07
39	0.09
40	0.14
41	0.2
42	0.21
43	0.22
44	0.28
45	0.36
46	0.43
47	0.47
48	0.52
49	0.56
50	0.64
51	0.69
52	0.73
53	0.76
54	0.72
55	0.71
56	0.65
57	0.64
58	0.58
59	0.54
60	0.48
61	0.46
62	0.46
63	0.46
64	0.49
65	0.43
66	0.4
67	0.39
68	0.35
69	0.28
70	0.27
71	0.24
72	0.21
73	0.19
74	0.21
75	0.21
76	0.21
77	0.18
78	0.15
79	0.18
80	0.21
81	0.21
82	0.19
83	0.19
84	0.19
85	0.21
86	0.25
87	0.22
88	0.18
89	0.23
90	0.23
91	0.24
92	0.25
93	0.23
94	0.19
95	0.18
96	0.17
97	0.13
98	0.12
99	0.12
100	0.13
101	0.12
102	0.12
103	0.12
104	0.13
105	0.11
106	0.17
107	0.2
108	0.25
109	0.25
110	0.28
111	0.32
112	0.3
113	0.32
114	0.27
115	0.31
116	0.3
117	0.34
118	0.42
119	0.4
120	0.43
121	0.42
122	0.43
123	0.35
124	0.35
125	0.37
126	0.33
127	0.38
128	0.43
129	0.49
130	0.57
131	0.63
132	0.6
133	0.64
134	0.67
135	0.63
136	0.62
137	0.6
138	0.53
139	0.48
140	0.45
141	0.36
142	0.28
143	0.24
144	0.18
145	0.12
146	0.09
147	0.08
148	0.07
149	0.07
150	0.07
151	0.07
152	0.07
153	0.08
154	0.07
155	0.08
156	0.1
157	0.16
158	0.17
159	0.17
160	0.18
161	0.22
162	0.26
163	0.27
164	0.25
165	0.23
166	0.22
167	0.25
168	0.24
169	0.22
170	0.2
171	0.2
172	0.24
173	0.23
174	0.27
175	0.25
176	0.27
177	0.29
178	0.3
179	0.31
180	0.3
181	0.28
182	0.24
183	0.23
184	0.2
185	0.17
186	0.13
187	0.11
188	0.07
189	0.04
190	0.04
191	0.04
192	0.04
193	0.03
194	0.03
195	0.04
196	0.03
197	0.04
198	0.03
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.03
205	0.03
206	0.03
207	0.03
208	0.03
209	0.03
210	0.04
211	0.04
212	0.05
213	0.05
214	0.07
215	0.07
216	0.07
217	0.07
218	0.12
219	0.12
220	0.14
221	0.17
222	0.17
223	0.19
224	0.21
225	0.21
226	0.19
227	0.18
228	0.15
229	0.13
230	0.12
231	0.1
232	0.09
233	0.11
234	0.1
235	0.12
236	0.13
237	0.16
238	0.16
239	0.16
240	0.15
241	0.13
242	0.14
243	0.12
244	0.12
245	0.08
246	0.08
247	0.08
248	0.08
249	0.08
250	0.06
251	0.06
252	0.05
253	0.05
254	0.05
255	0.04
256	0.05
257	0.07
258	0.09
259	0.1
260	0.11
261	0.12
262	0.21
263	0.24
264	0.24
265	0.22
266	0.21
267	0.21
268	0.21
269	0.21
270	0.13
271	0.1
272	0.08
273	0.08
274	0.07
275	0.06
276	0.05
277	0.05
278	0.05
279	0.06
280	0.07
281	0.08
282	0.11
283	0.12
284	0.13
285	0.15
286	0.15
287	0.19
288	0.18
289	0.19
290	0.18
291	0.17
292	0.17
293	0.17
294	0.19
295	0.14
296	0.15
297	0.15
298	0.18
299	0.18
300	0.18
301	0.18
302	0.15
303	0.14
304	0.13
305	0.11
306	0.06
307	0.06
308	0.06
309	0.06
310	0.05
311	0.06
312	0.08
313	0.09
314	0.11
315	0.16
316	0.22
317	0.25
318	0.28
319	0.36
320	0.42
321	0.5
322	0.55
323	0.55
324	0.55
325	0.57
326	0.59
327	0.6
328	0.62
329	0.56
330	0.53
331	0.57
332	0.61
333	0.63
334	0.63
335	0.6
336	0.54
337	0.52
338	0.5
339	0.46
340	0.38
341	0.33
342	0.31
343	0.27
344	0.25
345	0.24
346	0.23
347	0.2
348	0.2
349	0.18
350	0.17
351	0.15
352	0.15
353	0.16
354	0.17
355	0.19
356	0.19
357	0.25
358	0.24
359	0.25
360	0.29
361	0.33
362	0.36
363	0.37
364	0.4
365	0.38
366	0.43
367	0.42
368	0.39
369	0.34
370	0.29
371	0.27
372	0.2
373	0.2
374	0.16
375	0.16
376	0.15
377	0.14
378	0.15
379	0.13
380	0.14
381	0.1
382	0.09
383	0.13
384	0.14
385	0.16
386	0.16
387	0.17
388	0.17
389	0.22
390	0.24
391	0.21
392	0.19
393	0.18
394	0.21
395	0.22
396	0.24
397	0.2
398	0.17
399	0.19
400	0.18
401	0.17
402	0.15
403	0.13
404	0.1
405	0.1
406	0.1
407	0.07
408	0.08
409	0.09
410	0.11
411	0.1
412	0.11
413	0.13
414	0.12
415	0.13
416	0.16
417	0.16
418	0.15
419	0.18
420	0.2
421	0.2
422	0.21
423	0.21
424	0.2
425	0.21
426	0.2
427	0.18
428	0.16
429	0.18
430	0.17
431	0.22
432	0.2
433	0.22
434	0.28
435	0.33
436	0.36
437	0.43
438	0.47
439	0.47
440	0.52
441	0.57
442	0.54
443	0.53
444	0.53
445	0.53
446	0.51
447	0.45
448	0.45
449	0.41
450	0.4
451	0.37
452	0.34
453	0.31
454	0.29
455	0.34
456	0.36
457	0.36
458	0.38
459	0.38
460	0.42
461	0.41
462	0.42
463	0.42
464	0.45
465	0.48
466	0.51
467	0.57
468	0.59
469	0.61
470	0.66
471	0.62
472	0.59
473	0.56
474	0.49
475	0.41
476	0.36
477	0.3
478	0.29

A0A0F4YUY7

3D AlphaFold-predicted Structure Viewer