Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YPD7

Protein Details
Accession A0A0F4YPD7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-57YILQNKRRGRPKPTRKQTYTHydrophilic
NLS Segment(s)
PositionSequence
43-52KRRGRPKPTR
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences CICRKYVPPDFSPSQLVQYPVRHLIYLPPTRKLGGDLYILQNKRRGRPKPTRKQTYTHETHEPIFKLASRPLLNFESNQNVHVTSIAVAFHTTDPSAPATQICKYVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.34
4 0.31
5 0.31
6 0.32
7 0.32
8 0.32
9 0.28
10 0.26
11 0.29
12 0.33
13 0.39
14 0.37
15 0.35
16 0.36
17 0.36
18 0.36
19 0.32
20 0.26
21 0.2
22 0.2
23 0.18
24 0.22
25 0.27
26 0.28
27 0.27
28 0.3
29 0.3
30 0.35
31 0.41
32 0.42
33 0.45
34 0.56
35 0.66
36 0.72
37 0.8
38 0.83
39 0.77
40 0.77
41 0.75
42 0.73
43 0.67
44 0.6
45 0.54
46 0.46
47 0.44
48 0.43
49 0.36
50 0.28
51 0.23
52 0.2
53 0.17
54 0.17
55 0.22
56 0.19
57 0.19
58 0.23
59 0.26
60 0.26
61 0.24
62 0.25
63 0.27
64 0.26
65 0.26
66 0.23
67 0.2
68 0.19
69 0.18
70 0.16
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.09
77 0.09
78 0.1
79 0.1
80 0.09
81 0.11
82 0.14
83 0.14
84 0.14
85 0.15
86 0.17
87 0.19