Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YSK3

Protein Details
Accession A0A0F4YSK3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
158-181KAVAVRKHLERHRKDKDSKFRLILBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012606  Ribosomal_S13/S15_N  
IPR000589  Ribosomal_S15  
IPR023029  Ribosomal_S15P  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF08069  Ribosomal_S13_N  
PF00312  Ribosomal_S15  
PROSITE View protein in PROSITE  
PS00362  RIBOSOMAL_S15  
CDD cd00353  Ribosomal_S15p_S13e  
Amino Acid Sequences MGRLHSKGKGISSSAIPYSRTPPAWLKTTPEQVVDQICKLARKGATPSQIGVILRDSHGIAQVKVVTDSAYPEVQRYEASLNSDRCSRMKRWSESEDWMGCSLAANREWSLFPLLSAASTRNPKLSVQNRLHISIICLCLARCLAPEIPEDLYFLIKKAVAVRKHLERHRKDKDSKFRLILIESRIHRLSRYYKTVGVLPPTWRYESATASTLVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.3
4 0.28
5 0.31
6 0.33
7 0.31
8 0.31
9 0.35
10 0.37
11 0.4
12 0.4
13 0.42
14 0.44
15 0.51
16 0.48
17 0.43
18 0.4
19 0.38
20 0.42
21 0.37
22 0.3
23 0.26
24 0.26
25 0.25
26 0.24
27 0.27
28 0.22
29 0.23
30 0.29
31 0.33
32 0.37
33 0.37
34 0.37
35 0.33
36 0.35
37 0.31
38 0.26
39 0.21
40 0.16
41 0.15
42 0.15
43 0.14
44 0.11
45 0.16
46 0.16
47 0.14
48 0.14
49 0.15
50 0.15
51 0.15
52 0.14
53 0.1
54 0.09
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.12
61 0.12
62 0.11
63 0.11
64 0.11
65 0.11
66 0.15
67 0.2
68 0.21
69 0.22
70 0.25
71 0.24
72 0.25
73 0.28
74 0.26
75 0.3
76 0.37
77 0.4
78 0.44
79 0.47
80 0.49
81 0.48
82 0.5
83 0.42
84 0.35
85 0.3
86 0.24
87 0.19
88 0.16
89 0.13
90 0.09
91 0.09
92 0.09
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.09
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.13
108 0.14
109 0.15
110 0.16
111 0.25
112 0.3
113 0.36
114 0.37
115 0.43
116 0.44
117 0.44
118 0.44
119 0.35
120 0.31
121 0.25
122 0.22
123 0.16
124 0.14
125 0.12
126 0.13
127 0.13
128 0.11
129 0.08
130 0.1
131 0.1
132 0.11
133 0.12
134 0.14
135 0.15
136 0.15
137 0.15
138 0.12
139 0.13
140 0.12
141 0.11
142 0.1
143 0.09
144 0.1
145 0.16
146 0.23
147 0.24
148 0.29
149 0.35
150 0.42
151 0.5
152 0.57
153 0.61
154 0.62
155 0.7
156 0.75
157 0.79
158 0.8
159 0.82
160 0.86
161 0.83
162 0.82
163 0.75
164 0.69
165 0.62
166 0.56
167 0.5
168 0.43
169 0.43
170 0.37
171 0.39
172 0.38
173 0.36
174 0.33
175 0.35
176 0.38
177 0.39
178 0.44
179 0.42
180 0.43
181 0.45
182 0.5
183 0.48
184 0.46
185 0.41
186 0.39
187 0.41
188 0.42
189 0.42
190 0.37
191 0.37
192 0.35
193 0.35
194 0.34
195 0.3