Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YGP0

Protein Details
Accession A0A0F4YGP0   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-97FLFNNHARGVRKQRKKNKKKEKDKKTLASKYFTPHydrophilic
NLS Segment(s)
PositionSequence
71-88RGVRKQRKKNKKKEKDKK
Subcellular Location(s) mito 14, plas 3, E.R. 3, golg 3, nucl 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences VIMRSVCNNEEWRMKCRSRSFFFCKELLFIYLFIYYLLSWYFIPYMICFRNMHVTVTHAKWLFFLFNNHARGVRKQRKKNKKKEKDKKTLASKYFTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.55
4 0.6
5 0.58
6 0.64
7 0.68
8 0.68
9 0.68
10 0.62
11 0.54
12 0.46
13 0.4
14 0.33
15 0.26
16 0.18
17 0.15
18 0.12
19 0.12
20 0.1
21 0.09
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.11
33 0.1
34 0.12
35 0.12
36 0.13
37 0.19
38 0.19
39 0.2
40 0.16
41 0.18
42 0.2
43 0.2
44 0.24
45 0.18
46 0.17
47 0.17
48 0.18
49 0.17
50 0.15
51 0.17
52 0.18
53 0.24
54 0.26
55 0.26
56 0.28
57 0.29
58 0.36
59 0.44
60 0.49
61 0.53
62 0.61
63 0.72
64 0.8
65 0.89
66 0.93
67 0.93
68 0.94
69 0.95
70 0.96
71 0.96
72 0.96
73 0.95
74 0.94
75 0.94
76 0.93
77 0.87