Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4Z4S2

Protein Details
Accession A0A0F4Z4S2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-95KAATGYKNCKKKRYMREICSVPMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MIGRQTPPALLPLATIPIAKAFRRLKYWPTTVMAGLIPKPTVKPKSRPWVRNCCHILFGWLKEKAKSDPEQPKAATGYKNCKKKRYMREICSVPMSAITDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.15
5 0.18
6 0.17
7 0.25
8 0.27
9 0.3
10 0.36
11 0.4
12 0.41
13 0.46
14 0.49
15 0.44
16 0.43
17 0.4
18 0.35
19 0.32
20 0.26
21 0.2
22 0.17
23 0.14
24 0.12
25 0.1
26 0.12
27 0.17
28 0.23
29 0.27
30 0.33
31 0.4
32 0.51
33 0.6
34 0.67
35 0.68
36 0.72
37 0.7
38 0.72
39 0.68
40 0.58
41 0.5
42 0.42
43 0.38
44 0.29
45 0.29
46 0.26
47 0.26
48 0.26
49 0.26
50 0.28
51 0.27
52 0.3
53 0.3
54 0.33
55 0.39
56 0.42
57 0.46
58 0.44
59 0.44
60 0.42
61 0.43
62 0.39
63 0.35
64 0.41
65 0.44
66 0.54
67 0.56
68 0.61
69 0.66
70 0.71
71 0.77
72 0.78
73 0.81
74 0.78
75 0.83
76 0.8
77 0.75
78 0.69
79 0.59
80 0.47
81 0.39
82 0.34