Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YH60

Protein Details
Accession A0A0F4YH60   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRRRCSWPKRSVRKQYKRTPGRRCTPCSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MRRRCSWPKRSVRKQYKRTPGRRCTPCSLVRLLLNCSLALRQRQLACGHGSCVLADRRCGPEAPAGARPVDGAAGVFPEPARRRYRDVCVLGRFALRLQPGCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.93
5 0.92
6 0.92
7 0.9
8 0.9
9 0.88
10 0.85
11 0.81
12 0.77
13 0.73
14 0.66
15 0.59
16 0.51
17 0.45
18 0.4
19 0.36
20 0.31
21 0.26
22 0.22
23 0.19
24 0.18
25 0.17
26 0.17
27 0.16
28 0.17
29 0.17
30 0.2
31 0.21
32 0.22
33 0.21
34 0.19
35 0.19
36 0.17
37 0.16
38 0.13
39 0.15
40 0.16
41 0.13
42 0.14
43 0.15
44 0.16
45 0.17
46 0.17
47 0.16
48 0.17
49 0.19
50 0.21
51 0.22
52 0.2
53 0.19
54 0.19
55 0.18
56 0.14
57 0.11
58 0.08
59 0.05
60 0.04
61 0.05
62 0.06
63 0.06
64 0.06
65 0.13
66 0.16
67 0.22
68 0.28
69 0.3
70 0.37
71 0.43
72 0.51
73 0.53
74 0.58
75 0.6
76 0.58
77 0.58
78 0.52
79 0.48
80 0.41
81 0.32
82 0.3
83 0.26