Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YRE5

Protein Details
Accession A0A0F4YRE5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
96-133GVAQKIEKASRQQRKQRKNRAKKFRGTAKTKGPKKSKEBasic
NLS Segment(s)
PositionSequence
103-133KASRQQRKQRKNRAKKFRGTAKTKGPKKSKE
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFLRNPLLSRKQMVVDVLHPNRPNVSKAELREKLAELYKTNADQVSVFGFRTQYGGGKSTGFALIYDSHEALKKFEPYYRLVRMGVAQKIEKASRQQRKQRKNRAKKFRGTAKTKGPKKSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.74
5 0.79
6 0.74
7 0.69
8 0.61
9 0.54
10 0.45
11 0.4
12 0.31
13 0.26
14 0.32
15 0.32
16 0.35
17 0.34
18 0.33
19 0.35
20 0.35
21 0.32
22 0.25
23 0.28
24 0.27
25 0.3
26 0.39
27 0.38
28 0.39
29 0.39
30 0.37
31 0.35
32 0.34
33 0.32
34 0.23
35 0.23
36 0.22
37 0.2
38 0.2
39 0.17
40 0.14
41 0.12
42 0.12
43 0.11
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.1
50 0.09
51 0.08
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.12
68 0.13
69 0.13
70 0.14
71 0.16
72 0.16
73 0.19
74 0.21
75 0.23
76 0.29
77 0.31
78 0.31
79 0.28
80 0.28
81 0.29
82 0.32
83 0.31
84 0.28
85 0.24
86 0.23
87 0.27
88 0.27
89 0.26
90 0.3
91 0.38
92 0.45
93 0.54
94 0.63
95 0.7
96 0.8
97 0.88
98 0.9
99 0.92
100 0.93
101 0.94
102 0.95
103 0.94
104 0.93
105 0.92
106 0.91
107 0.9
108 0.86
109 0.84
110 0.84
111 0.84
112 0.82
113 0.82