Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YEN1

Protein Details
Accession A0A0F4YEN1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-124SCKVLLMRSKHRLNKGKRNKGLAHydrophilic
NLS Segment(s)
PositionSequence
111-122KHRLNKGKRNKG
Subcellular Location(s) mito 10, cyto 9, cyto_nucl 8.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences AFLQLVCGTLTEEYGLNKNGKFQPVVNVDDLLYLVHHSMAISEEGFPTPRQRQQHNTLRKMMTSTSARPGTLLESSGYFRSNDALKWGDIQLFMVKVPDYPSCKVLLMRSKHRLNKGKRNKGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.18
4 0.18
5 0.24
6 0.27
7 0.3
8 0.3
9 0.28
10 0.33
11 0.35
12 0.38
13 0.32
14 0.29
15 0.26
16 0.24
17 0.23
18 0.14
19 0.1
20 0.07
21 0.06
22 0.05
23 0.05
24 0.04
25 0.05
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.09
33 0.09
34 0.13
35 0.16
36 0.21
37 0.25
38 0.29
39 0.36
40 0.45
41 0.54
42 0.59
43 0.6
44 0.6
45 0.57
46 0.52
47 0.47
48 0.38
49 0.33
50 0.26
51 0.23
52 0.23
53 0.23
54 0.23
55 0.21
56 0.21
57 0.18
58 0.16
59 0.15
60 0.09
61 0.09
62 0.11
63 0.11
64 0.12
65 0.1
66 0.1
67 0.11
68 0.12
69 0.11
70 0.13
71 0.14
72 0.13
73 0.15
74 0.16
75 0.15
76 0.14
77 0.15
78 0.13
79 0.11
80 0.11
81 0.1
82 0.1
83 0.09
84 0.12
85 0.16
86 0.19
87 0.21
88 0.22
89 0.23
90 0.25
91 0.26
92 0.3
93 0.34
94 0.37
95 0.44
96 0.52
97 0.6
98 0.66
99 0.74
100 0.77
101 0.79
102 0.82
103 0.84
104 0.86