Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YP22

Protein Details
Accession A0A0F4YP22   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-103KGGPVWTTRRRSNRDRRKEGDGGPBasic
NLS Segment(s)
PositionSequence
87-106TRRRSNRDRRKEGDGGPKQK
Subcellular Location(s) extr 21, golg 3, mito 1, plas 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences LNTTLIASLYLIILCQTLLWAYRSLILVPVTNQQNEALSNTATQDETLPRKIDRIRHTRSRDLGRSIDKISRGVQQGPWKGGPVWTTRRRSNRDRRKEGDGGPKQKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.08
7 0.09
8 0.1
9 0.12
10 0.13
11 0.13
12 0.15
13 0.14
14 0.14
15 0.14
16 0.2
17 0.2
18 0.19
19 0.2
20 0.18
21 0.18
22 0.17
23 0.17
24 0.12
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.09
31 0.08
32 0.11
33 0.13
34 0.15
35 0.16
36 0.16
37 0.19
38 0.22
39 0.28
40 0.32
41 0.38
42 0.43
43 0.51
44 0.56
45 0.59
46 0.62
47 0.63
48 0.59
49 0.54
50 0.52
51 0.47
52 0.44
53 0.4
54 0.38
55 0.31
56 0.29
57 0.26
58 0.27
59 0.26
60 0.25
61 0.27
62 0.32
63 0.35
64 0.37
65 0.36
66 0.32
67 0.3
68 0.3
69 0.28
70 0.27
71 0.33
72 0.38
73 0.44
74 0.51
75 0.6
76 0.66
77 0.74
78 0.78
79 0.8
80 0.82
81 0.86
82 0.82
83 0.81
84 0.81
85 0.78
86 0.78
87 0.77