Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YG78

Protein Details
Accession A0A0F4YG78    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-45QSLHPPGRVQHQRQRRRPGHDRRHGHDPRBasic
NLS Segment(s)
PositionSequence
24-61RVQHQRQRRRPGHDRRHGHDPRRERDPRGSGVHPARKA
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences IHRLRSLQRRPNRHDAQSLHPPGRVQHQRQRRRPGHDRRHGHDPRRERDPRGSGVHPARKAGDAGRGGQCGDHARADGVYDGAEFVVGGGVKIVDINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.7
3 0.69
4 0.69
5 0.67
6 0.58
7 0.52
8 0.47
9 0.4
10 0.46
11 0.47
12 0.44
13 0.46
14 0.55
15 0.64
16 0.73
17 0.82
18 0.79
19 0.8
20 0.83
21 0.85
22 0.85
23 0.85
24 0.83
25 0.77
26 0.81
27 0.78
28 0.75
29 0.71
30 0.69
31 0.63
32 0.65
33 0.63
34 0.56
35 0.56
36 0.52
37 0.5
38 0.46
39 0.43
40 0.4
41 0.45
42 0.47
43 0.41
44 0.38
45 0.34
46 0.3
47 0.3
48 0.24
49 0.23
50 0.18
51 0.21
52 0.22
53 0.21
54 0.2
55 0.19
56 0.2
57 0.17
58 0.17
59 0.14
60 0.12
61 0.13
62 0.13
63 0.13
64 0.12
65 0.09
66 0.08
67 0.07
68 0.06
69 0.06
70 0.05
71 0.04
72 0.04
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05