Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YD75

Protein Details
Accession A0A0F4YD75    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-33LYRTRLPPLSPRSTRRPRRWCPRASGCHRATHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, E.R. 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences AFLYRTRLPPLSPRSTRRPRRWCPRASGCHRATRFVFTAVIFSVCVILQFANGSPPTGEIRRPVPAVNSADPYRSVCIYRPSSHVTIPLYPTCQIIGASQLGMCCVWLRDIGQMCIEPLFQLDDRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.8
4 0.82
5 0.84
6 0.85
7 0.88
8 0.91
9 0.88
10 0.87
11 0.87
12 0.87
13 0.84
14 0.84
15 0.77
16 0.76
17 0.7
18 0.65
19 0.56
20 0.5
21 0.44
22 0.35
23 0.32
24 0.23
25 0.23
26 0.18
27 0.17
28 0.11
29 0.09
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.11
44 0.11
45 0.12
46 0.12
47 0.14
48 0.16
49 0.17
50 0.15
51 0.14
52 0.18
53 0.21
54 0.2
55 0.22
56 0.2
57 0.2
58 0.2
59 0.2
60 0.17
61 0.14
62 0.14
63 0.12
64 0.19
65 0.23
66 0.24
67 0.27
68 0.3
69 0.31
70 0.31
71 0.33
72 0.28
73 0.26
74 0.28
75 0.26
76 0.23
77 0.21
78 0.21
79 0.18
80 0.16
81 0.14
82 0.11
83 0.12
84 0.1
85 0.1
86 0.1
87 0.1
88 0.1
89 0.09
90 0.09
91 0.07
92 0.07
93 0.07
94 0.08
95 0.09
96 0.15
97 0.18
98 0.19
99 0.21
100 0.2
101 0.2
102 0.2
103 0.19
104 0.13
105 0.11
106 0.14