Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YI43

Protein Details
Accession A0A0F4YI43    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-94RIAPPRLPCPCRRRRRAVRAGGIRVACHydrophilic
NLS Segment(s)
PositionSequence
81-83RRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, cyto 3.5, mito 3, extr 3
Family & Domain DBs
Amino Acid Sequences LPPHTPSTEYTRASAQNAVGGSPNSGLLPPHPSAGSSGSARSARSDTWSSPSRSAGQSSTRSGSGSPRIAPPRLPCPCRRRRRAVRAGGIRVXACRRGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.28
3 0.24
4 0.22
5 0.21
6 0.18
7 0.16
8 0.14
9 0.12
10 0.12
11 0.09
12 0.09
13 0.09
14 0.08
15 0.12
16 0.12
17 0.13
18 0.13
19 0.13
20 0.14
21 0.16
22 0.17
23 0.13
24 0.13
25 0.15
26 0.16
27 0.16
28 0.16
29 0.15
30 0.13
31 0.16
32 0.18
33 0.16
34 0.2
35 0.25
36 0.25
37 0.25
38 0.26
39 0.25
40 0.23
41 0.24
42 0.21
43 0.22
44 0.23
45 0.24
46 0.25
47 0.22
48 0.22
49 0.21
50 0.22
51 0.23
52 0.22
53 0.21
54 0.26
55 0.29
56 0.3
57 0.33
58 0.34
59 0.38
60 0.44
61 0.48
62 0.5
63 0.57
64 0.66
65 0.73
66 0.78
67 0.79
68 0.82
69 0.88
70 0.9
71 0.9
72 0.9
73 0.89
74 0.85
75 0.81
76 0.73
77 0.66
78 0.59
79 0.53