Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YG93

Protein Details
Accession A0A0F4YG93   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-32MASVYKSISKKEKKKKERPVAAEDGDHydrophilic
NLS Segment(s)
PositionSequence
16-24KKEKKKKER
Subcellular Location(s) nucl 17.5, mito_nucl 12, mito 5.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MWTIPTMASVYKSISKKEKKKKERPVAAEDGDVTMDDVMENGIDDTSDSEEEEEQEEQEETQEQSGSGSGQQQQQTQTQNKSGLMPKTRVLMLTSRGVTYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.56
4 0.65
5 0.73
6 0.77
7 0.86
8 0.92
9 0.93
10 0.93
11 0.89
12 0.87
13 0.83
14 0.74
15 0.64
16 0.53
17 0.42
18 0.32
19 0.24
20 0.16
21 0.08
22 0.06
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.08
40 0.07
41 0.06
42 0.06
43 0.07
44 0.06
45 0.06
46 0.07
47 0.06
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.06
55 0.09
56 0.11
57 0.16
58 0.18
59 0.2
60 0.22
61 0.27
62 0.33
63 0.37
64 0.38
65 0.38
66 0.39
67 0.37
68 0.4
69 0.41
70 0.41
71 0.41
72 0.4
73 0.37
74 0.38
75 0.38
76 0.34
77 0.31
78 0.27
79 0.26
80 0.3
81 0.3