Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YX78

Protein Details
Accession A0A0F4YX78   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-40LWKIPWRLSRTQKARQRKRLRHVDQVIDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 14.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLLGGLLWKIPWRLSRTQKARQRKRLRHVDQVIDTVSAALRNNGMPQIKTIERWYAEMPREQEMLPRDKYTIYDRKERNYRKGIHSECPSNGSPRCESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.22
5 0.26
6 0.34
7 0.41
8 0.51
9 0.57
10 0.66
11 0.73
12 0.78
13 0.84
14 0.86
15 0.88
16 0.87
17 0.89
18 0.91
19 0.88
20 0.87
21 0.82
22 0.78
23 0.69
24 0.61
25 0.51
26 0.4
27 0.33
28 0.23
29 0.17
30 0.1
31 0.08
32 0.06
33 0.06
34 0.06
35 0.07
36 0.1
37 0.1
38 0.09
39 0.1
40 0.14
41 0.14
42 0.15
43 0.16
44 0.17
45 0.17
46 0.19
47 0.2
48 0.21
49 0.23
50 0.25
51 0.25
52 0.24
53 0.24
54 0.22
55 0.25
56 0.23
57 0.27
58 0.25
59 0.25
60 0.23
61 0.22
62 0.25
63 0.29
64 0.33
65 0.32
66 0.4
67 0.42
68 0.5
69 0.61
70 0.66
71 0.67
72 0.68
73 0.7
74 0.69
75 0.76
76 0.72
77 0.7
78 0.7
79 0.66
80 0.59
81 0.58
82 0.52
83 0.48
84 0.48
85 0.44