Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YFF7

Protein Details
Accession A0A0F4YFF7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-80PRTSVKKKSGGDKKKKKYSLHMTEKKENKDBasic
NLS Segment(s)
PositionSequence
52-68RTSVKKKSGGDKKKKKY
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MEISGIGRILYREERHIKPPVIILYVKPLVNVSLENVKFKLDLILIARSAPRTSVKKKSGGDKKKKKYSLHMTEKKENKDKDDKTVSDTNQQTNLTAGLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.49
4 0.46
5 0.42
6 0.44
7 0.39
8 0.35
9 0.32
10 0.27
11 0.27
12 0.29
13 0.27
14 0.23
15 0.2
16 0.17
17 0.17
18 0.17
19 0.12
20 0.16
21 0.17
22 0.18
23 0.18
24 0.18
25 0.17
26 0.17
27 0.16
28 0.08
29 0.09
30 0.1
31 0.11
32 0.11
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.12
39 0.17
40 0.22
41 0.31
42 0.34
43 0.41
44 0.44
45 0.52
46 0.59
47 0.64
48 0.7
49 0.71
50 0.78
51 0.81
52 0.86
53 0.8
54 0.8
55 0.8
56 0.8
57 0.8
58 0.79
59 0.76
60 0.78
61 0.82
62 0.79
63 0.77
64 0.69
65 0.65
66 0.67
67 0.62
68 0.62
69 0.64
70 0.57
71 0.54
72 0.59
73 0.54
74 0.53
75 0.54
76 0.49
77 0.46
78 0.45
79 0.39
80 0.32