Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YGY9

Protein Details
Accession A0A0F4YGY9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24PSTGRVRRSRRVRERARNRAGPVEBasic
NLS Segment(s)
PositionSequence
6-19VRRSRRVRERARNR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences PSTGRVRRSRRVRERARNRAGPVEQPAGDAASAHRNHDVRDAEGDGVTGAGERAFGDREGSIDHAGAGAEEAAKWQRSFVESSQVSSTEYDLRDMLCHEVCRARYTISTVLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.93
4 0.89
5 0.82
6 0.79
7 0.71
8 0.65
9 0.59
10 0.53
11 0.43
12 0.37
13 0.33
14 0.25
15 0.22
16 0.17
17 0.12
18 0.15
19 0.16
20 0.16
21 0.2
22 0.2
23 0.21
24 0.27
25 0.27
26 0.2
27 0.22
28 0.22
29 0.18
30 0.18
31 0.17
32 0.1
33 0.09
34 0.07
35 0.05
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.05
43 0.06
44 0.05
45 0.06
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.03
56 0.03
57 0.03
58 0.04
59 0.06
60 0.07
61 0.07
62 0.08
63 0.09
64 0.11
65 0.14
66 0.14
67 0.22
68 0.21
69 0.24
70 0.25
71 0.25
72 0.24
73 0.21
74 0.22
75 0.17
76 0.17
77 0.16
78 0.15
79 0.15
80 0.15
81 0.15
82 0.18
83 0.16
84 0.16
85 0.18
86 0.23
87 0.24
88 0.27
89 0.27
90 0.25
91 0.25
92 0.29
93 0.35