Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YI92

Protein Details
Accession A0A0F4YI92    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-96RRSAPRQTRASRRRRGKRLARGRCLCHRSVRNEEKKKRRNEDRKRTLAKVQRBasic
NLS Segment(s)
PositionSequence
44-69GRRSAPRQTRASRRRRGKRLARGRCL
71-90HRSVRNEEKKKRRNEDRKRT
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences KCCKCFKTSPSGSSARSTCAPVCQKYTSVSLSADMLVGCRPLPGRRSAPRQTRASRRRRGKRLARGRCLCHRSVRNEEKKKRRNEDRKRTLAKVQRCQRLPRILPVAVDAKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.37
4 0.36
5 0.3
6 0.33
7 0.37
8 0.34
9 0.37
10 0.36
11 0.35
12 0.35
13 0.37
14 0.31
15 0.26
16 0.24
17 0.19
18 0.18
19 0.16
20 0.14
21 0.1
22 0.09
23 0.07
24 0.07
25 0.06
26 0.06
27 0.07
28 0.1
29 0.12
30 0.17
31 0.24
32 0.3
33 0.38
34 0.46
35 0.54
36 0.59
37 0.64
38 0.65
39 0.69
40 0.73
41 0.75
42 0.76
43 0.77
44 0.8
45 0.81
46 0.84
47 0.83
48 0.84
49 0.86
50 0.86
51 0.86
52 0.82
53 0.79
54 0.78
55 0.73
56 0.65
57 0.62
58 0.58
59 0.55
60 0.59
61 0.64
62 0.65
63 0.71
64 0.79
65 0.81
66 0.84
67 0.87
68 0.87
69 0.88
70 0.88
71 0.89
72 0.9
73 0.9
74 0.92
75 0.89
76 0.83
77 0.82
78 0.79
79 0.78
80 0.77
81 0.76
82 0.75
83 0.73
84 0.76
85 0.75
86 0.76
87 0.7
88 0.68
89 0.66
90 0.58
91 0.53
92 0.5
93 0.46