Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YEB8

Protein Details
Accession A0A0F4YEB8   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-36FYRIVGKIRKKQEKKRRKKGKRERGKRERGRGRGVABasic
NLS Segment(s)
PositionSequence
7-34KIRKKQEKKRRKKGKRERGKRERGRGRG
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences FYRIVGKIRKKQEKKRRKKGKRERGKRERGRGRGVASKVWNDSNNNEIKTPPLLGNQHHILAINETIRVDADRMIIASYVSVWSTPTAIHLICQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.95
4 0.95
5 0.96
6 0.96
7 0.96
8 0.96
9 0.96
10 0.96
11 0.96
12 0.96
13 0.94
14 0.94
15 0.93
16 0.88
17 0.84
18 0.78
19 0.71
20 0.67
21 0.59
22 0.53
23 0.46
24 0.41
25 0.35
26 0.33
27 0.31
28 0.25
29 0.25
30 0.25
31 0.26
32 0.24
33 0.22
34 0.19
35 0.18
36 0.17
37 0.17
38 0.13
39 0.14
40 0.15
41 0.16
42 0.2
43 0.21
44 0.21
45 0.19
46 0.19
47 0.15
48 0.14
49 0.15
50 0.11
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.08
72 0.08
73 0.09
74 0.12