Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YI52

Protein Details
Accession A0A0F4YI52    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-59TIKNSRSKKINSKKINSKNNNKTNPNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 7.5, extr 5, cyto_nucl 5, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTASFNYYTSFSFKLAQAVGILGSAGASILIITIKNSRSKKINSKKINSKNNNKTNPNLLQLQQRVIYHTSSTNGSTSTTKEAKPSRTSSQDRLSHTLHYSILPVYSNLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.2
4 0.19
5 0.16
6 0.15
7 0.13
8 0.1
9 0.09
10 0.05
11 0.04
12 0.04
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.03
19 0.03
20 0.04
21 0.08
22 0.1
23 0.18
24 0.19
25 0.23
26 0.29
27 0.35
28 0.45
29 0.53
30 0.61
31 0.63
32 0.71
33 0.78
34 0.82
35 0.86
36 0.84
37 0.84
38 0.84
39 0.85
40 0.84
41 0.76
42 0.68
43 0.64
44 0.58
45 0.5
46 0.42
47 0.34
48 0.32
49 0.31
50 0.31
51 0.27
52 0.24
53 0.23
54 0.22
55 0.21
56 0.16
57 0.16
58 0.15
59 0.14
60 0.15
61 0.13
62 0.12
63 0.13
64 0.13
65 0.14
66 0.19
67 0.21
68 0.2
69 0.27
70 0.32
71 0.36
72 0.41
73 0.45
74 0.46
75 0.53
76 0.58
77 0.58
78 0.63
79 0.63
80 0.62
81 0.61
82 0.56
83 0.51
84 0.47
85 0.42
86 0.34
87 0.28
88 0.24
89 0.2
90 0.19
91 0.16