Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YIN2

Protein Details
Accession A0A0F4YIN2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-43HQLCTENQRQKRKRQASRYFIQHydrophilic
60-85HEQLQESSRRPRRPPRCSNCNQEGHNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences DKVIKCAEITMQNAILLQQEIHQLCTENQRQKRKRQASRYFIQAGGSLTGAEGQQKAQEHEQLQESSRRPRRPPRCSNCNQEGHNRLKCPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.13
4 0.11
5 0.09
6 0.14
7 0.14
8 0.16
9 0.16
10 0.16
11 0.17
12 0.25
13 0.31
14 0.34
15 0.41
16 0.51
17 0.57
18 0.65
19 0.75
20 0.77
21 0.8
22 0.82
23 0.85
24 0.82
25 0.79
26 0.76
27 0.68
28 0.57
29 0.48
30 0.38
31 0.28
32 0.21
33 0.17
34 0.1
35 0.07
36 0.07
37 0.06
38 0.06
39 0.05
40 0.05
41 0.08
42 0.09
43 0.11
44 0.12
45 0.16
46 0.16
47 0.19
48 0.22
49 0.21
50 0.22
51 0.26
52 0.28
53 0.34
54 0.41
55 0.46
56 0.5
57 0.59
58 0.68
59 0.73
60 0.81
61 0.81
62 0.83
63 0.85
64 0.87
65 0.85
66 0.83
67 0.76
68 0.75
69 0.73
70 0.71
71 0.71
72 0.65