FuNGI

A0A0F4YS87

Protein Details

Accession

A0A0F4YS87

Localization Confidence

Low

Confidence Score

8.2

NoLS Segment(s)

Position	Sequence	Protein Nature
30-49	PRNTLRRREFPQPISRNRSS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 17, nucl 8

Family & Domain DBs

InterPro	View protein in InterPro IPR005552 Scramblase
Gene Ontology	GO:0017128 F:phospholipid scramblase activity
Pfam	View protein in Pfam PF03803 Scramblase

Amino Acid Sequences

MWGRQFRPPALRWVNRNSRALRIPAGLRGPRNTLRRREFPQPISRNRSSPKNAPSDVPPEQLSSNYEYLSSTLRDTSPEQNSLLSPVHIPEDPNAILKERHPAAKILANSGLVVQRQLELMNVMLGFEQANRYVILDANGNHVGYMAEQESGFGSMMARQWFRTHRSFVTHVFDKDENEVLRFHRPFAWINSRIRVYDPLELANPSYSPSGTLQGASPTALVSVAGGSNVKVSPLAIEDMRVVGEAQQRWAPLRRKYDLFIFHPTPTSQTDMGSKPISSDALSQPQQTQLLHASGGQNTGGEYHQFAYVDEPFLSWDFSLRSADNRLIGSVNRNFTGFAREIFTDTGVYALRMDAAALAEEREQRHLISQTGQAPTAYTGNFTGMTLDQRAVMLATAVSIDFDYFSRHSHAGGGFMPLWFPGVGSEASAGGAAAGEAGAAGAGAGAAAAGSEAAAASQAAGAAEAAAVGETGAGALGRAGTAGSLGEAAAAGAAGAGTMAGYEAMRRGLYSDPQTSLPGEQRQEPPQPQKDEELWGESYEDFWAQGGGANRGEEFEGEEEEEEGDDWF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.74
2	0.72
3	0.78
4	0.7
5	0.68
6	0.67
7	0.64
8	0.58
9	0.52
10	0.47
11	0.46
12	0.51
13	0.48
14	0.47
15	0.47
16	0.5
17	0.52
18	0.59
19	0.61
20	0.63
21	0.66
22	0.7
23	0.72
24	0.75
25	0.77
26	0.76
27	0.79
28	0.78
29	0.8
30	0.81
31	0.79
32	0.77
33	0.73
34	0.74
35	0.7
36	0.7
37	0.68
38	0.68
39	0.66
40	0.61
41	0.61
42	0.59
43	0.55
44	0.5
45	0.42
46	0.36
47	0.34
48	0.33
49	0.3
50	0.27
51	0.24
52	0.21
53	0.2
54	0.18
55	0.18
56	0.19
57	0.18
58	0.14
59	0.15
60	0.15
61	0.18
62	0.22
63	0.29
64	0.31
65	0.32
66	0.31
67	0.3
68	0.3
69	0.31
70	0.28
71	0.21
72	0.17
73	0.15
74	0.17
75	0.16
76	0.17
77	0.15
78	0.19
79	0.19
80	0.21
81	0.21
82	0.21
83	0.21
84	0.21
85	0.28
86	0.25
87	0.29
88	0.28
89	0.28
90	0.3
91	0.34
92	0.34
93	0.3
94	0.29
95	0.24
96	0.23
97	0.23
98	0.22
99	0.16
100	0.16
101	0.13
102	0.11
103	0.11
104	0.11
105	0.1
106	0.08
107	0.08
108	0.09
109	0.08
110	0.07
111	0.07
112	0.07
113	0.07
114	0.07
115	0.08
116	0.07
117	0.08
118	0.08
119	0.09
120	0.1
121	0.1
122	0.11
123	0.12
124	0.12
125	0.16
126	0.17
127	0.16
128	0.15
129	0.14
130	0.13
131	0.1
132	0.12
133	0.08
134	0.07
135	0.07
136	0.08
137	0.08
138	0.09
139	0.09
140	0.07
141	0.06
142	0.07
143	0.11
144	0.14
145	0.14
146	0.14
147	0.18
148	0.23
149	0.28
150	0.32
151	0.33
152	0.33
153	0.38
154	0.41
155	0.41
156	0.44
157	0.43
158	0.39
159	0.39
160	0.37
161	0.32
162	0.31
163	0.3
164	0.23
165	0.2
166	0.21
167	0.18
168	0.25
169	0.24
170	0.23
171	0.23
172	0.25
173	0.27
174	0.32
175	0.4
176	0.37
177	0.4
178	0.44
179	0.42
180	0.4
181	0.39
182	0.36
183	0.3
184	0.28
185	0.26
186	0.22
187	0.22
188	0.22
189	0.2
190	0.16
191	0.14
192	0.1
193	0.1
194	0.08
195	0.09
196	0.1
197	0.12
198	0.11
199	0.12
200	0.11
201	0.11
202	0.12
203	0.1
204	0.09
205	0.07
206	0.06
207	0.06
208	0.05
209	0.04
210	0.04
211	0.04
212	0.04
213	0.04
214	0.04
215	0.05
216	0.05
217	0.05
218	0.05
219	0.05
220	0.05
221	0.06
222	0.08
223	0.06
224	0.07
225	0.07
226	0.07
227	0.07
228	0.07
229	0.06
230	0.08
231	0.12
232	0.12
233	0.13
234	0.14
235	0.14
236	0.16
237	0.24
238	0.27
239	0.3
240	0.36
241	0.38
242	0.39
243	0.4
244	0.44
245	0.43
246	0.4
247	0.4
248	0.36
249	0.33
250	0.32
251	0.3
252	0.27
253	0.22
254	0.22
255	0.16
256	0.14
257	0.17
258	0.16
259	0.19
260	0.17
261	0.16
262	0.13
263	0.14
264	0.13
265	0.1
266	0.12
267	0.11
268	0.17
269	0.18
270	0.18
271	0.18
272	0.19
273	0.2
274	0.16
275	0.16
276	0.12
277	0.11
278	0.11
279	0.11
280	0.11
281	0.1
282	0.11
283	0.09
284	0.07
285	0.07
286	0.08
287	0.07
288	0.06
289	0.06
290	0.06
291	0.07
292	0.08
293	0.08
294	0.09
295	0.09
296	0.1
297	0.1
298	0.09
299	0.08
300	0.09
301	0.09
302	0.07
303	0.07
304	0.07
305	0.08
306	0.09
307	0.09
308	0.1
309	0.12
310	0.13
311	0.14
312	0.14
313	0.13
314	0.13
315	0.13
316	0.17
317	0.19
318	0.19
319	0.18
320	0.18
321	0.18
322	0.17
323	0.21
324	0.16
325	0.13
326	0.14
327	0.14
328	0.15
329	0.15
330	0.15
331	0.1
332	0.1
333	0.1
334	0.08
335	0.07
336	0.06
337	0.06
338	0.05
339	0.05
340	0.05
341	0.04
342	0.04
343	0.04
344	0.04
345	0.05
346	0.06
347	0.09
348	0.1
349	0.12
350	0.13
351	0.12
352	0.16
353	0.17
354	0.16
355	0.17
356	0.2
357	0.23
358	0.24
359	0.24
360	0.2
361	0.19
362	0.19
363	0.18
364	0.14
365	0.1
366	0.09
367	0.1
368	0.1
369	0.1
370	0.1
371	0.09
372	0.1
373	0.1
374	0.1
375	0.09
376	0.09
377	0.09
378	0.08
379	0.07
380	0.05
381	0.04
382	0.04
383	0.04
384	0.04
385	0.04
386	0.04
387	0.04
388	0.04
389	0.05
390	0.08
391	0.08
392	0.1
393	0.14
394	0.14
395	0.14
396	0.17
397	0.17
398	0.16
399	0.16
400	0.18
401	0.15
402	0.14
403	0.14
404	0.11
405	0.11
406	0.09
407	0.08
408	0.06
409	0.07
410	0.07
411	0.07
412	0.08
413	0.07
414	0.07
415	0.07
416	0.06
417	0.04
418	0.04
419	0.03
420	0.03
421	0.02
422	0.02
423	0.02
424	0.02
425	0.02
426	0.02
427	0.02
428	0.02
429	0.02
430	0.02
431	0.01
432	0.01
433	0.01
434	0.01
435	0.02
436	0.02
437	0.02
438	0.02
439	0.02
440	0.02
441	0.02
442	0.02
443	0.03
444	0.03
445	0.03
446	0.03
447	0.04
448	0.04
449	0.04
450	0.03
451	0.03
452	0.03
453	0.03
454	0.03
455	0.02
456	0.02
457	0.02
458	0.02
459	0.02
460	0.02
461	0.02
462	0.03
463	0.03
464	0.03
465	0.03
466	0.03
467	0.03
468	0.03
469	0.04
470	0.04
471	0.04
472	0.04
473	0.04
474	0.04
475	0.04
476	0.03
477	0.03
478	0.03
479	0.02
480	0.02
481	0.02
482	0.02
483	0.02
484	0.02
485	0.02
486	0.02
487	0.03
488	0.03
489	0.04
490	0.05
491	0.07
492	0.07
493	0.08
494	0.1
495	0.13
496	0.19
497	0.24
498	0.27
499	0.28
500	0.3
501	0.32
502	0.31
503	0.32
504	0.32
505	0.33
506	0.32
507	0.36
508	0.4
509	0.45
510	0.52
511	0.57
512	0.61
513	0.63
514	0.67
515	0.63
516	0.64
517	0.6
518	0.58
519	0.52
520	0.46
521	0.39
522	0.33
523	0.31
524	0.25
525	0.23
526	0.18
527	0.15
528	0.11
529	0.09
530	0.09
531	0.07
532	0.11
533	0.13
534	0.15
535	0.16
536	0.17
537	0.17
538	0.18
539	0.18
540	0.15
541	0.15
542	0.13
543	0.14
544	0.14
545	0.15
546	0.14
547	0.14
548	0.14

A0A0F4YS87

3D AlphaFold-predicted Structure Viewer