Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YFP5

Protein Details
Accession A0A0F4YFP5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-51LFAAHEKEKQKRQRSKKKIHHEGGITBasic
NLS Segment(s)
PositionSequence
32-44KEKQKRQRSKKKI
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences AFDQITKACESIMIQAAIMKKQYQDLFAAHEKEKQKRQRSKKKIHHEGGITREEAQDLMRSRDQVVEPPVNDPPQSQLPASQPRQRAPQKCSNCGIVGHTRVRCPERTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.2
4 0.2
5 0.21
6 0.17
7 0.14
8 0.19
9 0.21
10 0.2
11 0.2
12 0.19
13 0.24
14 0.27
15 0.31
16 0.26
17 0.31
18 0.35
19 0.39
20 0.48
21 0.52
22 0.57
23 0.63
24 0.74
25 0.79
26 0.85
27 0.89
28 0.9
29 0.92
30 0.92
31 0.87
32 0.82
33 0.75
34 0.69
35 0.63
36 0.55
37 0.44
38 0.34
39 0.28
40 0.22
41 0.17
42 0.13
43 0.12
44 0.11
45 0.14
46 0.14
47 0.14
48 0.15
49 0.18
50 0.18
51 0.17
52 0.21
53 0.21
54 0.21
55 0.22
56 0.24
57 0.22
58 0.22
59 0.19
60 0.18
61 0.18
62 0.2
63 0.18
64 0.19
65 0.24
66 0.33
67 0.38
68 0.41
69 0.41
70 0.43
71 0.53
72 0.58
73 0.6
74 0.59
75 0.64
76 0.65
77 0.67
78 0.67
79 0.61
80 0.54
81 0.48
82 0.45
83 0.42
84 0.41
85 0.42
86 0.41
87 0.4
88 0.45
89 0.49
90 0.48