Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4Z588

Protein Details
Accession A0A0F4Z588   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25TAYFRGRKLRGRRVELPEGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 4.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013924  RNase_H2_suC  
Gene Ontology GO:0032299  C:ribonuclease H2 complex  
GO:0006401  P:RNA catabolic process  
Pfam View protein in Pfam  
PF08615  RNase_H2_suC  
CDD cd09271  RNase_H2-C  
Amino Acid Sequences QEIGQTAYFRGRKLRGRRVELPEGYEGVVAVPTDRILPASNPGVKTDYSQNEQDGAIDGDSEEPVKVLEKQATFNEFVVWGHEVLPAADDPFVKGVEEWLKFAEAMHSSAPPSTENGKPGSSTEQTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.69
4 0.77
5 0.78
6 0.8
7 0.73
8 0.66
9 0.58
10 0.49
11 0.41
12 0.32
13 0.23
14 0.14
15 0.12
16 0.08
17 0.06
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.07
24 0.08
25 0.11
26 0.16
27 0.19
28 0.19
29 0.2
30 0.21
31 0.2
32 0.22
33 0.25
34 0.24
35 0.24
36 0.25
37 0.24
38 0.23
39 0.23
40 0.21
41 0.15
42 0.12
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.06
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.1
56 0.1
57 0.13
58 0.15
59 0.17
60 0.17
61 0.17
62 0.16
63 0.13
64 0.12
65 0.12
66 0.11
67 0.09
68 0.08
69 0.09
70 0.08
71 0.08
72 0.09
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.07
81 0.07
82 0.1
83 0.15
84 0.16
85 0.17
86 0.16
87 0.17
88 0.17
89 0.17
90 0.17
91 0.13
92 0.14
93 0.14
94 0.14
95 0.14
96 0.15
97 0.16
98 0.13
99 0.15
100 0.18
101 0.2
102 0.22
103 0.24
104 0.25
105 0.25
106 0.26
107 0.3
108 0.28