Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YDC1

Protein Details
Accession A0A0F4YDC1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-36KLIIIAKKKRNQGTKKKTNLEGHydrophilic
NLS Segment(s)
PositionSequence
21-30KKKRNQGTKK
Subcellular Location(s) cyto 19.5, cyto_mito 12.999, cyto_nucl 12.166, mito 5, mito_nucl 4.499
Family & Domain DBs
Amino Acid Sequences AELVETVESLVLKLKLIIIAKKKRNQGTKKKTNLEGADCSIVEDHAAQGLERMLVVLPLEDRGMPAVPASHTVVGLSVTLMPQVRPHNLSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.16
4 0.22
5 0.28
6 0.37
7 0.46
8 0.52
9 0.59
10 0.64
11 0.71
12 0.76
13 0.78
14 0.79
15 0.81
16 0.84
17 0.83
18 0.79
19 0.77
20 0.7
21 0.63
22 0.55
23 0.47
24 0.38
25 0.31
26 0.27
27 0.19
28 0.15
29 0.11
30 0.08
31 0.05
32 0.05
33 0.05
34 0.04
35 0.05
36 0.05
37 0.05
38 0.04
39 0.05
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.1
56 0.12
57 0.11
58 0.11
59 0.11
60 0.11
61 0.1
62 0.1
63 0.08
64 0.06
65 0.06
66 0.08
67 0.09
68 0.09
69 0.13
70 0.18
71 0.23
72 0.25