Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YK16

Protein Details
Accession A0A0F4YK16    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-37FHSMPRRRPILRPRRPRMPSRRIRRMLBasic
NLS Segment(s)
PositionSequence
15-52PRRRPILRPRRPRMPSRRIRRMLARASSGRDVGRRRQA
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MPFHSSHYILFHSMPRRRPILRPRRPRMPSRRIRRMLARASSGRDVGRRRQAARLRLVLLVAADGGSVEFGSATKIDGESCSSFLCCGDVGSVNAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.48
4 0.49
5 0.57
6 0.61
7 0.64
8 0.68
9 0.73
10 0.76
11 0.81
12 0.83
13 0.85
14 0.84
15 0.84
16 0.83
17 0.83
18 0.86
19 0.8
20 0.79
21 0.77
22 0.74
23 0.71
24 0.64
25 0.59
26 0.5
27 0.49
28 0.45
29 0.38
30 0.31
31 0.28
32 0.27
33 0.28
34 0.34
35 0.34
36 0.34
37 0.41
38 0.46
39 0.47
40 0.49
41 0.46
42 0.4
43 0.37
44 0.35
45 0.27
46 0.21
47 0.14
48 0.09
49 0.06
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.02
56 0.02
57 0.03
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.07
64 0.08
65 0.12
66 0.12
67 0.14
68 0.14
69 0.14
70 0.14
71 0.14
72 0.14
73 0.1
74 0.09
75 0.1
76 0.11