Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YRE6

Protein Details
Accession A0A0F4YRE6   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-32PAATTTSGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
11-26GKKQKKKWSKGKVKDK
Subcellular Location(s) mito_nucl 10, nucl 9.5, mito 9.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATTTSGGKKQKKKWSKGKVKDKANHAVVLDKATSEKLYKDVQSYRLITVATLVDRLKINGSLARKALAELEEKGQIKKVVGHSKLNIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.76
3 0.81
4 0.84
5 0.87
6 0.9
7 0.91
8 0.93
9 0.91
10 0.91
11 0.88
12 0.84
13 0.82
14 0.74
15 0.65
16 0.54
17 0.48
18 0.38
19 0.33
20 0.26
21 0.16
22 0.14
23 0.12
24 0.13
25 0.1
26 0.1
27 0.11
28 0.13
29 0.14
30 0.18
31 0.2
32 0.22
33 0.26
34 0.27
35 0.24
36 0.23
37 0.21
38 0.17
39 0.15
40 0.13
41 0.08
42 0.09
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.1
50 0.12
51 0.15
52 0.16
53 0.16
54 0.17
55 0.16
56 0.16
57 0.17
58 0.15
59 0.15
60 0.14
61 0.15
62 0.2
63 0.21
64 0.21
65 0.23
66 0.23
67 0.21
68 0.25
69 0.32
70 0.35
71 0.39
72 0.44
73 0.44
74 0.51
75 0.57
76 0.55
77 0.49
78 0.42
79 0.41