Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YQA5

Protein Details
Accession A0A0F4YQA5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
197-217GLFWYCSKDSQRRRRESDVDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 8, mito 5, cyto 2.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
Pfam View protein in Pfam  
PF01753  zf-MYND  
Amino Acid Sequences MTTNNPVLETDLELEPANLRDDENVFPTLSTLPSTDNIDFDFYNSVDGTFYVPTRHWCLLAEIVNVHFFFRLLLVVRDKAGRHLPVYFYTEERGWDFFAHVTSSVLSASQQNHDHLSLPQQGYTIAILYAHRHLFMDLSVGVKQLELDSIKIIPTSLDNLLELSDQVRTYSAKANGQRACHGCGQRKDSLLKCSKCGLFWYCSKDSQRRRRESDVDASVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.15
5 0.12
6 0.12
7 0.13
8 0.16
9 0.17
10 0.19
11 0.19
12 0.17
13 0.16
14 0.17
15 0.16
16 0.14
17 0.13
18 0.11
19 0.12
20 0.13
21 0.18
22 0.17
23 0.17
24 0.17
25 0.19
26 0.18
27 0.17
28 0.17
29 0.12
30 0.14
31 0.13
32 0.12
33 0.1
34 0.1
35 0.1
36 0.09
37 0.1
38 0.1
39 0.11
40 0.14
41 0.2
42 0.2
43 0.19
44 0.19
45 0.21
46 0.24
47 0.26
48 0.23
49 0.18
50 0.18
51 0.2
52 0.19
53 0.16
54 0.12
55 0.09
56 0.08
57 0.07
58 0.08
59 0.07
60 0.1
61 0.12
62 0.13
63 0.14
64 0.16
65 0.16
66 0.18
67 0.21
68 0.2
69 0.19
70 0.19
71 0.2
72 0.21
73 0.24
74 0.21
75 0.18
76 0.18
77 0.18
78 0.17
79 0.17
80 0.15
81 0.12
82 0.11
83 0.11
84 0.1
85 0.1
86 0.09
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.05
93 0.05
94 0.07
95 0.08
96 0.11
97 0.12
98 0.13
99 0.14
100 0.14
101 0.15
102 0.13
103 0.16
104 0.18
105 0.17
106 0.16
107 0.16
108 0.15
109 0.14
110 0.14
111 0.1
112 0.05
113 0.05
114 0.05
115 0.07
116 0.1
117 0.09
118 0.09
119 0.09
120 0.1
121 0.09
122 0.09
123 0.09
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.08
131 0.06
132 0.08
133 0.07
134 0.07
135 0.08
136 0.08
137 0.09
138 0.09
139 0.08
140 0.07
141 0.07
142 0.09
143 0.09
144 0.09
145 0.09
146 0.1
147 0.1
148 0.1
149 0.09
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.09
156 0.11
157 0.17
158 0.21
159 0.26
160 0.31
161 0.39
162 0.41
163 0.43
164 0.48
165 0.44
166 0.44
167 0.44
168 0.47
169 0.47
170 0.51
171 0.54
172 0.52
173 0.54
174 0.57
175 0.54
176 0.58
177 0.59
178 0.54
179 0.51
180 0.54
181 0.51
182 0.45
183 0.46
184 0.41
185 0.36
186 0.4
187 0.45
188 0.41
189 0.47
190 0.53
191 0.58
192 0.64
193 0.69
194 0.74
195 0.76
196 0.8
197 0.82
198 0.81
199 0.78
200 0.77