Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YGF4

Protein Details
Accession A0A0F4YGF4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20GRRLHPRRRTSVQPGKRPGSBasic
NLS Segment(s)
PositionSequence
5-36HPRRRTSVQPGKRPGSAQRMRFLRQRFRQRLK
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences GRRLHPRRRTSVQPGKRPGSAQRMRFLRQRFRQRLKTIVERAAGRGRAGEALPVGRLAMEPVMLFQTDGLEEASACSYIAHTENNNTYLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.73
4 0.66
5 0.63
6 0.62
7 0.6
8 0.54
9 0.53
10 0.54
11 0.55
12 0.58
13 0.58
14 0.58
15 0.6
16 0.67
17 0.69
18 0.73
19 0.79
20 0.76
21 0.76
22 0.72
23 0.71
24 0.64
25 0.58
26 0.52
27 0.44
28 0.42
29 0.39
30 0.34
31 0.25
32 0.2
33 0.16
34 0.14
35 0.13
36 0.11
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.08
66 0.1
67 0.12
68 0.13
69 0.19
70 0.22
71 0.24