Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4Z6T1

Protein Details
Accession A0A0F4Z6T1    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-59SDPKDLGDKNNKKRKNKTKTQERGGAGBasic
105-124DPEHHKKGKGKEKAERRDSSBasic
NLS Segment(s)
PositionSequence
43-51NKKRKNKTK
109-120HKKGKGKEKAER
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSPQNEPIVSHGRGGQGNIGADPTKYVYTYSISDPKDLGDKNNKKRKNKTKTQERGGAGNIGSPNVRPSTPGKAHDTEVVPEISIRPSDGDYHTGRGGQGNVHLDPEHHKKGKGKEKAERRDSSTSTATSSHSRHHEGLADRLKHKILGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.21
4 0.21
5 0.19
6 0.19
7 0.15
8 0.14
9 0.14
10 0.14
11 0.12
12 0.11
13 0.12
14 0.12
15 0.14
16 0.16
17 0.2
18 0.25
19 0.25
20 0.26
21 0.26
22 0.25
23 0.28
24 0.27
25 0.28
26 0.31
27 0.4
28 0.5
29 0.59
30 0.66
31 0.69
32 0.8
33 0.85
34 0.84
35 0.85
36 0.85
37 0.87
38 0.89
39 0.88
40 0.85
41 0.76
42 0.68
43 0.59
44 0.5
45 0.39
46 0.32
47 0.24
48 0.16
49 0.14
50 0.11
51 0.11
52 0.1
53 0.1
54 0.09
55 0.12
56 0.2
57 0.23
58 0.26
59 0.29
60 0.3
61 0.31
62 0.32
63 0.3
64 0.23
65 0.21
66 0.18
67 0.13
68 0.11
69 0.11
70 0.08
71 0.07
72 0.07
73 0.06
74 0.07
75 0.09
76 0.1
77 0.14
78 0.14
79 0.16
80 0.17
81 0.16
82 0.16
83 0.15
84 0.15
85 0.11
86 0.13
87 0.14
88 0.14
89 0.15
90 0.14
91 0.14
92 0.19
93 0.26
94 0.3
95 0.3
96 0.33
97 0.38
98 0.48
99 0.57
100 0.61
101 0.62
102 0.64
103 0.72
104 0.8
105 0.83
106 0.78
107 0.74
108 0.72
109 0.66
110 0.62
111 0.56
112 0.46
113 0.39
114 0.35
115 0.31
116 0.3
117 0.29
118 0.3
119 0.32
120 0.36
121 0.35
122 0.36
123 0.4
124 0.37
125 0.45
126 0.48
127 0.48
128 0.44
129 0.46
130 0.46