Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YXL9

Protein Details
Accession A0A0F4YXL9   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
241-260DKAAEEKASRRKGCRRKGCRBasic
NLS Segment(s)
PositionSequence
248-257ASRRKGCRRK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 8.5, mito 1, extr 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009053  Prefoldin  
IPR039553  Prefoldin-like  
Pfam View protein in Pfam  
PF13758  Prefoldin_3  
CDD cd00890  Prefoldin  
Amino Acid Sequences MATVDDTIADLERQRLQLEENVRKLQQSLYHWRLWEAEYDGLKEEIASLKDGSTKDDILRKGREFAGTVVDEKEVKDLIGEGQGLTRSRDQVVQRISRRLDYVKQNVRSMEKQLEAAETKLDSFLSVEHPGPITKDAEFPVTEIVEELDEEGNVISGKTTTPGERAPELLEVLKKVGINDIPNKISDKISKIGAQANKSEGKALEEKTLEKKALEEKAPNEESSDEEVLDEKAAEEKAAEDKAAEEKASRRKGCRRKGCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.25
5 0.33
6 0.39
7 0.41
8 0.45
9 0.45
10 0.45
11 0.43
12 0.41
13 0.38
14 0.37
15 0.41
16 0.41
17 0.45
18 0.44
19 0.45
20 0.43
21 0.37
22 0.34
23 0.27
24 0.27
25 0.24
26 0.25
27 0.25
28 0.23
29 0.22
30 0.18
31 0.15
32 0.13
33 0.13
34 0.13
35 0.12
36 0.12
37 0.17
38 0.17
39 0.19
40 0.19
41 0.19
42 0.21
43 0.27
44 0.3
45 0.32
46 0.38
47 0.36
48 0.37
49 0.37
50 0.36
51 0.31
52 0.28
53 0.28
54 0.23
55 0.22
56 0.19
57 0.19
58 0.17
59 0.16
60 0.16
61 0.11
62 0.09
63 0.08
64 0.08
65 0.07
66 0.09
67 0.09
68 0.07
69 0.08
70 0.1
71 0.11
72 0.13
73 0.13
74 0.13
75 0.14
76 0.19
77 0.19
78 0.24
79 0.3
80 0.36
81 0.38
82 0.43
83 0.43
84 0.4
85 0.41
86 0.37
87 0.37
88 0.37
89 0.43
90 0.45
91 0.47
92 0.48
93 0.48
94 0.49
95 0.44
96 0.4
97 0.34
98 0.27
99 0.24
100 0.22
101 0.23
102 0.19
103 0.17
104 0.14
105 0.1
106 0.1
107 0.09
108 0.08
109 0.06
110 0.05
111 0.05
112 0.07
113 0.09
114 0.09
115 0.09
116 0.1
117 0.1
118 0.1
119 0.11
120 0.09
121 0.08
122 0.1
123 0.1
124 0.11
125 0.11
126 0.11
127 0.1
128 0.09
129 0.09
130 0.07
131 0.07
132 0.05
133 0.05
134 0.06
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.03
143 0.03
144 0.04
145 0.05
146 0.06
147 0.07
148 0.09
149 0.11
150 0.14
151 0.15
152 0.15
153 0.15
154 0.15
155 0.15
156 0.15
157 0.14
158 0.12
159 0.12
160 0.13
161 0.12
162 0.11
163 0.13
164 0.13
165 0.16
166 0.21
167 0.25
168 0.24
169 0.25
170 0.27
171 0.26
172 0.26
173 0.26
174 0.25
175 0.23
176 0.25
177 0.26
178 0.25
179 0.31
180 0.32
181 0.31
182 0.3
183 0.32
184 0.33
185 0.31
186 0.31
187 0.24
188 0.24
189 0.27
190 0.26
191 0.27
192 0.25
193 0.28
194 0.31
195 0.35
196 0.32
197 0.27
198 0.28
199 0.3
200 0.35
201 0.36
202 0.36
203 0.34
204 0.42
205 0.44
206 0.42
207 0.36
208 0.31
209 0.3
210 0.3
211 0.28
212 0.19
213 0.17
214 0.18
215 0.16
216 0.16
217 0.13
218 0.08
219 0.1
220 0.1
221 0.1
222 0.09
223 0.1
224 0.14
225 0.15
226 0.14
227 0.12
228 0.13
229 0.18
230 0.19
231 0.18
232 0.17
233 0.23
234 0.33
235 0.43
236 0.47
237 0.52
238 0.61
239 0.71
240 0.79