Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YLK2

Protein Details
Accession A0A0F4YLK2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-69IQESKPGERKKKKKSLSSSKSKQEVQHydrophilic
NLS Segment(s)
PositionSequence
48-59KPGERKKKKKSL
Subcellular Location(s) extr 17, mito 3, golg 3, plas 1, cyto_nucl 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQTTYNPHLGQVGRISLYLALLVFIGLVNQLHLLVYCMYDVFYIQESKPGERKKKKKSLSSSKSKQEVQTGLSPVYIKERVGQGPYYKYRPPYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.15
4 0.14
5 0.12
6 0.08
7 0.06
8 0.05
9 0.05
10 0.04
11 0.04
12 0.04
13 0.03
14 0.03
15 0.03
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.12
33 0.13
34 0.14
35 0.21
36 0.27
37 0.36
38 0.45
39 0.54
40 0.61
41 0.7
42 0.76
43 0.79
44 0.83
45 0.85
46 0.84
47 0.86
48 0.83
49 0.82
50 0.8
51 0.74
52 0.66
53 0.61
54 0.53
55 0.46
56 0.44
57 0.37
58 0.32
59 0.29
60 0.27
61 0.21
62 0.24
63 0.22
64 0.17
65 0.18
66 0.22
67 0.23
68 0.26
69 0.3
70 0.29
71 0.36
72 0.42
73 0.45
74 0.45