Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YK00

Protein Details
Accession A0A0F4YK00    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
122-141KESKEGKKDKSKLKYQNAFKBasic
NLS Segment(s)
PositionSequence
92-105KEPTKAEKAANKGP
126-131EGKKDK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLREASNWFDQYNITANVASVIKDLHQRAQKTVARSQLPLPLALNSPRDDGWDVQIDNFNEDLSQYTLEKSERSATQLPVNFRFFMVRPKIKEPTKAEKAANKGPLYKKYKFKDFISLSNNKESKEGKKDKSKLKYQNAFKGEVKSYIYSLCSGESKYVSDPSWGYIYINSRIESIHNPMDNNCQRIGQDLHEGEGYLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.19
5 0.19
6 0.17
7 0.12
8 0.11
9 0.11
10 0.17
11 0.19
12 0.24
13 0.3
14 0.31
15 0.34
16 0.43
17 0.45
18 0.44
19 0.48
20 0.48
21 0.45
22 0.45
23 0.44
24 0.41
25 0.38
26 0.34
27 0.29
28 0.23
29 0.23
30 0.24
31 0.25
32 0.19
33 0.21
34 0.19
35 0.21
36 0.21
37 0.19
38 0.19
39 0.21
40 0.2
41 0.2
42 0.24
43 0.22
44 0.21
45 0.2
46 0.16
47 0.12
48 0.11
49 0.12
50 0.08
51 0.09
52 0.08
53 0.08
54 0.1
55 0.11
56 0.11
57 0.11
58 0.14
59 0.14
60 0.18
61 0.21
62 0.21
63 0.26
64 0.29
65 0.31
66 0.32
67 0.34
68 0.29
69 0.26
70 0.26
71 0.21
72 0.25
73 0.29
74 0.29
75 0.31
76 0.35
77 0.42
78 0.43
79 0.5
80 0.49
81 0.51
82 0.53
83 0.54
84 0.51
85 0.48
86 0.5
87 0.47
88 0.46
89 0.38
90 0.37
91 0.37
92 0.44
93 0.46
94 0.47
95 0.51
96 0.5
97 0.57
98 0.56
99 0.54
100 0.55
101 0.51
102 0.52
103 0.5
104 0.52
105 0.46
106 0.5
107 0.5
108 0.4
109 0.41
110 0.36
111 0.36
112 0.4
113 0.46
114 0.44
115 0.53
116 0.61
117 0.66
118 0.73
119 0.76
120 0.76
121 0.78
122 0.8
123 0.77
124 0.79
125 0.73
126 0.69
127 0.62
128 0.57
129 0.48
130 0.42
131 0.37
132 0.29
133 0.26
134 0.23
135 0.21
136 0.17
137 0.16
138 0.15
139 0.13
140 0.13
141 0.14
142 0.14
143 0.15
144 0.16
145 0.18
146 0.17
147 0.18
148 0.18
149 0.18
150 0.19
151 0.18
152 0.16
153 0.17
154 0.2
155 0.23
156 0.26
157 0.24
158 0.22
159 0.22
160 0.25
161 0.25
162 0.27
163 0.28
164 0.27
165 0.28
166 0.29
167 0.4
168 0.42
169 0.41
170 0.37
171 0.32
172 0.3
173 0.34
174 0.35
175 0.28
176 0.31
177 0.29
178 0.3
179 0.29