Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YGD0

Protein Details
Accession A0A0F4YGD0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
68-92TPLPRGSRSRRGSCPCRRSWPGRRRBasic
NLS Segment(s)
PositionSequence
90-92RRR
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences TTEQNRTTAYVYTCTNNILPSSSYLFMSTILTPPPTTNSAPSYTPSARAWSPHWPPRPASPAFRAGWTPLPRGSRSRRGSCPCRRSWPGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.18
5 0.17
6 0.15
7 0.15
8 0.19
9 0.17
10 0.17
11 0.16
12 0.16
13 0.14
14 0.15
15 0.13
16 0.11
17 0.11
18 0.11
19 0.11
20 0.11
21 0.13
22 0.15
23 0.15
24 0.16
25 0.17
26 0.19
27 0.19
28 0.2
29 0.23
30 0.2
31 0.22
32 0.2
33 0.2
34 0.18
35 0.19
36 0.21
37 0.23
38 0.3
39 0.35
40 0.4
41 0.39
42 0.41
43 0.45
44 0.49
45 0.44
46 0.42
47 0.38
48 0.39
49 0.38
50 0.37
51 0.32
52 0.29
53 0.34
54 0.32
55 0.31
56 0.29
57 0.32
58 0.33
59 0.4
60 0.45
61 0.48
62 0.53
63 0.58
64 0.63
65 0.69
66 0.77
67 0.8
68 0.81
69 0.79
70 0.8
71 0.81
72 0.81