Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YDP1

Protein Details
Accession A0A0F4YDP1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
114-134SACPARNARRKDSRGKPPGKPBasic
NLS Segment(s)
PositionSequence
120-134NARRKDSRGKPPGKP
Subcellular Location(s) mito 16, nucl 4, extr 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences TLWYERTKKRILCGYSSDRSNRVIETAGKYVIALQISGGLLASAVCLSGFFPAASIKRRFVSRAIKAHAPALVNGEIEDSKSLLPRPTNHGPPARSERHSFQCPIHQGPDAGQSACPARNARRKDSRGKPPGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.61
4 0.57
5 0.5
6 0.49
7 0.44
8 0.36
9 0.3
10 0.27
11 0.25
12 0.26
13 0.26
14 0.23
15 0.22
16 0.21
17 0.2
18 0.19
19 0.15
20 0.1
21 0.07
22 0.09
23 0.09
24 0.09
25 0.07
26 0.05
27 0.05
28 0.04
29 0.05
30 0.03
31 0.03
32 0.02
33 0.03
34 0.03
35 0.04
36 0.04
37 0.04
38 0.05
39 0.07
40 0.1
41 0.15
42 0.17
43 0.19
44 0.2
45 0.22
46 0.23
47 0.27
48 0.34
49 0.36
50 0.4
51 0.41
52 0.41
53 0.41
54 0.4
55 0.36
56 0.27
57 0.2
58 0.17
59 0.14
60 0.12
61 0.11
62 0.11
63 0.09
64 0.08
65 0.08
66 0.06
67 0.06
68 0.07
69 0.08
70 0.1
71 0.13
72 0.15
73 0.23
74 0.29
75 0.33
76 0.38
77 0.43
78 0.41
79 0.45
80 0.51
81 0.49
82 0.46
83 0.45
84 0.46
85 0.48
86 0.52
87 0.47
88 0.42
89 0.45
90 0.46
91 0.45
92 0.42
93 0.36
94 0.32
95 0.31
96 0.35
97 0.28
98 0.24
99 0.2
100 0.19
101 0.21
102 0.22
103 0.24
104 0.22
105 0.29
106 0.37
107 0.43
108 0.51
109 0.59
110 0.65
111 0.72
112 0.78
113 0.8
114 0.82