Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YFN6

Protein Details
Accession A0A0F4YFN6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-39ENRALKAANEKQKRKQERRRTYIGQEHydrophilic
NLS Segment(s)
PositionSequence
24-31KQKRKQER
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences RCMAMHSAAILAAENRALKAANEKQKRKQERRRTYIGQEDALTIEEGIDRVRRANEEESRVVEVTEERPQKRAARQCSICGTVGHTARTCSQRTRNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.09
6 0.17
7 0.25
8 0.33
9 0.43
10 0.49
11 0.58
12 0.68
13 0.79
14 0.81
15 0.84
16 0.85
17 0.86
18 0.87
19 0.87
20 0.82
21 0.78
22 0.76
23 0.68
24 0.58
25 0.47
26 0.4
27 0.32
28 0.26
29 0.2
30 0.1
31 0.07
32 0.06
33 0.05
34 0.05
35 0.06
36 0.05
37 0.06
38 0.07
39 0.08
40 0.11
41 0.17
42 0.2
43 0.24
44 0.25
45 0.26
46 0.28
47 0.27
48 0.24
49 0.18
50 0.16
51 0.14
52 0.2
53 0.24
54 0.23
55 0.25
56 0.29
57 0.34
58 0.41
59 0.48
60 0.48
61 0.52
62 0.54
63 0.58
64 0.59
65 0.57
66 0.5
67 0.42
68 0.37
69 0.34
70 0.33
71 0.31
72 0.26
73 0.26
74 0.3
75 0.35
76 0.35
77 0.36
78 0.44