Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YRJ0

Protein Details
Accession A0A0F4YRJ0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
372-397DKLASDLTKKKRKDKAKSATKDKGDDBasic
NLS Segment(s)
PositionSequence
380-391KKKRKDKAKSAT
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007052  CS_dom  
IPR008978  HSP20-like_chaperone  
IPR007699  SGS_dom  
IPR044563  Sgt1-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF04969  CS  
PF05002  SGS  
PROSITE View protein in PROSITE  
PS51203  CS  
PS51048  SGS  
CDD cd06466  p23_CS_SGT1_like  
Amino Acid Sequences MNAATQGDKAIANSDWPAAIKHFTDALIELPRAPSYYIKRSTAYLRRKPADGGPDFDAALRDAEIGLVLARERAKRELILDAQMRRAIALFQLERYGDAAYIFDIVKEKIETGRSKDKSTQMQAAATGQRSMEKHEQELSIWTIKVKGKLSKLGPDSEKAAVTIKEYPENVEIPGEEEMRKILKAQLAGEKAGSDAGTDKTETATNEPSPDKTKEATLDAAGPGSSAPMSAGPGAVPEKIRHEWYQSNDSVVVTLYAKGVPKDKLDVDLQNTSISVQFPLPSGAVYAFTLDPLYAPIDTTQSKIAVLSTKVEIVLRKQTPGQKWSALEASSTTANLTDRSTVVNDEAASTSSSKPSGPAYPTSSRHGVKDWDKLASDLTKKKRKDKAKSATKDKGDDGEKDAAEDAGAESDGAESIDSDYGTGDPVDAFFKKLYANADPDTRRAMVKSYYESEGTALSTNWEEVGKGRVPVRPPSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.16
5 0.16
6 0.19
7 0.17
8 0.18
9 0.18
10 0.17
11 0.18
12 0.17
13 0.19
14 0.2
15 0.19
16 0.18
17 0.19
18 0.19
19 0.19
20 0.19
21 0.23
22 0.26
23 0.35
24 0.4
25 0.42
26 0.43
27 0.45
28 0.53
29 0.56
30 0.6
31 0.6
32 0.64
33 0.64
34 0.65
35 0.65
36 0.61
37 0.61
38 0.54
39 0.49
40 0.42
41 0.4
42 0.38
43 0.35
44 0.3
45 0.2
46 0.18
47 0.13
48 0.1
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.08
57 0.11
58 0.14
59 0.17
60 0.2
61 0.23
62 0.24
63 0.26
64 0.3
65 0.29
66 0.34
67 0.36
68 0.35
69 0.36
70 0.36
71 0.33
72 0.27
73 0.24
74 0.18
75 0.14
76 0.19
77 0.16
78 0.16
79 0.19
80 0.18
81 0.19
82 0.19
83 0.17
84 0.11
85 0.1
86 0.09
87 0.07
88 0.09
89 0.08
90 0.08
91 0.09
92 0.09
93 0.11
94 0.11
95 0.12
96 0.13
97 0.19
98 0.22
99 0.27
100 0.38
101 0.39
102 0.42
103 0.48
104 0.52
105 0.54
106 0.55
107 0.55
108 0.47
109 0.45
110 0.42
111 0.4
112 0.37
113 0.29
114 0.25
115 0.18
116 0.2
117 0.19
118 0.25
119 0.28
120 0.26
121 0.27
122 0.3
123 0.3
124 0.27
125 0.29
126 0.26
127 0.21
128 0.19
129 0.18
130 0.19
131 0.21
132 0.26
133 0.27
134 0.3
135 0.31
136 0.38
137 0.4
138 0.43
139 0.43
140 0.44
141 0.42
142 0.38
143 0.38
144 0.32
145 0.3
146 0.23
147 0.22
148 0.16
149 0.16
150 0.19
151 0.17
152 0.19
153 0.19
154 0.2
155 0.2
156 0.2
157 0.18
158 0.14
159 0.13
160 0.12
161 0.13
162 0.12
163 0.1
164 0.1
165 0.1
166 0.11
167 0.11
168 0.1
169 0.11
170 0.12
171 0.14
172 0.16
173 0.21
174 0.21
175 0.22
176 0.21
177 0.18
178 0.16
179 0.15
180 0.12
181 0.06
182 0.06
183 0.07
184 0.08
185 0.08
186 0.08
187 0.09
188 0.1
189 0.11
190 0.12
191 0.14
192 0.14
193 0.17
194 0.17
195 0.18
196 0.21
197 0.22
198 0.22
199 0.2
200 0.21
201 0.19
202 0.2
203 0.19
204 0.16
205 0.15
206 0.13
207 0.12
208 0.1
209 0.08
210 0.06
211 0.05
212 0.04
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.04
219 0.04
220 0.05
221 0.06
222 0.07
223 0.08
224 0.08
225 0.12
226 0.13
227 0.16
228 0.16
229 0.2
230 0.23
231 0.26
232 0.32
233 0.28
234 0.28
235 0.25
236 0.24
237 0.2
238 0.16
239 0.13
240 0.07
241 0.07
242 0.06
243 0.07
244 0.08
245 0.09
246 0.12
247 0.13
248 0.13
249 0.15
250 0.15
251 0.17
252 0.19
253 0.2
254 0.21
255 0.21
256 0.21
257 0.18
258 0.17
259 0.15
260 0.13
261 0.11
262 0.09
263 0.07
264 0.07
265 0.08
266 0.09
267 0.08
268 0.07
269 0.07
270 0.06
271 0.07
272 0.07
273 0.08
274 0.07
275 0.07
276 0.07
277 0.06
278 0.06
279 0.06
280 0.07
281 0.05
282 0.06
283 0.06
284 0.09
285 0.1
286 0.11
287 0.11
288 0.11
289 0.11
290 0.11
291 0.11
292 0.11
293 0.12
294 0.12
295 0.12
296 0.12
297 0.13
298 0.14
299 0.14
300 0.14
301 0.22
302 0.21
303 0.21
304 0.26
305 0.32
306 0.36
307 0.39
308 0.39
309 0.35
310 0.35
311 0.36
312 0.34
313 0.28
314 0.23
315 0.2
316 0.18
317 0.15
318 0.14
319 0.11
320 0.09
321 0.09
322 0.1
323 0.1
324 0.09
325 0.09
326 0.11
327 0.12
328 0.12
329 0.12
330 0.13
331 0.12
332 0.12
333 0.12
334 0.11
335 0.11
336 0.12
337 0.12
338 0.12
339 0.13
340 0.12
341 0.12
342 0.15
343 0.19
344 0.2
345 0.23
346 0.28
347 0.35
348 0.38
349 0.42
350 0.46
351 0.42
352 0.41
353 0.4
354 0.41
355 0.39
356 0.44
357 0.41
358 0.38
359 0.37
360 0.36
361 0.36
362 0.34
363 0.36
364 0.36
365 0.44
366 0.5
367 0.55
368 0.64
369 0.7
370 0.75
371 0.79
372 0.81
373 0.82
374 0.85
375 0.89
376 0.9
377 0.9
378 0.85
379 0.78
380 0.69
381 0.66
382 0.58
383 0.51
384 0.45
385 0.42
386 0.37
387 0.33
388 0.31
389 0.24
390 0.2
391 0.17
392 0.12
393 0.07
394 0.07
395 0.06
396 0.05
397 0.06
398 0.06
399 0.05
400 0.05
401 0.04
402 0.06
403 0.07
404 0.07
405 0.07
406 0.07
407 0.07
408 0.08
409 0.08
410 0.07
411 0.06
412 0.07
413 0.11
414 0.11
415 0.13
416 0.12
417 0.14
418 0.14
419 0.17
420 0.21
421 0.22
422 0.26
423 0.28
424 0.36
425 0.37
426 0.38
427 0.4
428 0.37
429 0.34
430 0.3
431 0.31
432 0.28
433 0.31
434 0.35
435 0.35
436 0.37
437 0.36
438 0.35
439 0.32
440 0.27
441 0.23
442 0.18
443 0.14
444 0.13
445 0.13
446 0.13
447 0.13
448 0.13
449 0.11
450 0.12
451 0.18
452 0.18
453 0.21
454 0.24
455 0.28
456 0.32
457 0.41