Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4YHC0

Protein Details
Accession A0A0F4YHC0   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-37IEGNQENKKVHRQKRKRMYSTCTSCRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences YTHRWFGHDLIEGNQENKKVHRQKRKRMYSTCTSCRYYNCLTYNAEYLPDASSVTAAAINRLISAACTTSIVSSAYTNYWLETYVWSHHHTEVTARRFRHKDLAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.27
5 0.35
6 0.38
7 0.47
8 0.57
9 0.65
10 0.74
11 0.83
12 0.91
13 0.9
14 0.88
15 0.85
16 0.85
17 0.84
18 0.8
19 0.75
20 0.67
21 0.6
22 0.54
23 0.52
24 0.45
25 0.42
26 0.37
27 0.34
28 0.32
29 0.31
30 0.31
31 0.25
32 0.23
33 0.15
34 0.14
35 0.11
36 0.1
37 0.08
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.04
51 0.05
52 0.06
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.1
64 0.1
65 0.1
66 0.09
67 0.1
68 0.1
69 0.11
70 0.13
71 0.14
72 0.17
73 0.19
74 0.22
75 0.22
76 0.23
77 0.22
78 0.27
79 0.32
80 0.38
81 0.41
82 0.41
83 0.49
84 0.51
85 0.55
86 0.58