FuNGI

A0A0F4Z6G1

Protein Details

Accession

A0A0F4Z6G1

Localization Confidence

High

Confidence Score

18.3

NoLS Segment(s)

Position	Sequence	Protein Nature
43-77	SETQLRSRLKKWRVTKPSRQTRKKPQESQQQESNN	Hydrophilic
364-390	RVDRQGRQRKPASERKRKDQSSPNGVE	Hydrophilic

NLS Segment(s)

Position	Sequence
50-66	RLKKWRVTKPSRQTRKK
369-381	GRQRKPASERKRK

Subcellular Location(s)

nucl 24, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR025676 Clr5_dom
Pfam	View protein in Pfam PF14420 Clr5

Amino Acid Sequences

MKTSIPSDVWEKKKSLIARLYKDEEWPLKQVIKQIRTEDFNPSETQLRSRLKKWRVTKPSRQTRKKPQESQQQESNNADDDDGPEDPSPVESKKNNNNNNNNASHPTPQPQSTQQLQPPKDAAANPDWYSANGWFPPQQRQQQDMMQPPVMAPSLSVDTRDASVGSNWAPSAPAPAPAPAPAPESQSQQQSLNPQDNSNHIPNTTPAMQSFAMAAPTPISNVPMNSTPMVAPSYPNPGYAVSTEVCLPSPAPPMGAQWPTGTVHIEPDVNAGFPVANWFSAPFEPANPHFAAYYPQKAVNPSMAAYGQMMQPMPAQDMNQTFPQSPSVAGAFHSSLVDDLRYIRPWRRAMASHYGPEAANGHARVDRQGRQRKPASERKRKDQSSPNGVEMAAHQSQMQSMQTPMQPQFVASGQHPMMPQEMFGYSGHDQIVQRPPGN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.53
3	0.53
4	0.55
5	0.58
6	0.64
7	0.67
8	0.62
9	0.61
10	0.6
11	0.57
12	0.51
13	0.47
14	0.43
15	0.41
16	0.42
17	0.46
18	0.47
19	0.48
20	0.5
21	0.52
22	0.53
23	0.54
24	0.54
25	0.56
26	0.49
27	0.45
28	0.41
29	0.38
30	0.38
31	0.34
32	0.35
33	0.35
34	0.4
35	0.43
36	0.48
37	0.56
38	0.58
39	0.67
40	0.72
41	0.75
42	0.77
43	0.82
44	0.86
45	0.87
46	0.9
47	0.92
48	0.93
49	0.92
50	0.93
51	0.94
52	0.94
53	0.92
54	0.91
55	0.91
56	0.9
57	0.86
58	0.84
59	0.78
60	0.72
61	0.65
62	0.57
63	0.48
64	0.39
65	0.32
66	0.24
67	0.19
68	0.17
69	0.15
70	0.15
71	0.13
72	0.13
73	0.12
74	0.13
75	0.15
76	0.13
77	0.19
78	0.21
79	0.3
80	0.39
81	0.49
82	0.58
83	0.65
84	0.73
85	0.75
86	0.78
87	0.72
88	0.65
89	0.59
90	0.52
91	0.46
92	0.4
93	0.36
94	0.33
95	0.32
96	0.33
97	0.34
98	0.38
99	0.39
100	0.43
101	0.43
102	0.49
103	0.48
104	0.47
105	0.44
106	0.39
107	0.38
108	0.32
109	0.3
110	0.25
111	0.29
112	0.26
113	0.28
114	0.26
115	0.23
116	0.24
117	0.21
118	0.19
119	0.15
120	0.16
121	0.18
122	0.2
123	0.28
124	0.33
125	0.4
126	0.41
127	0.45
128	0.47
129	0.48
130	0.52
131	0.5
132	0.47
133	0.4
134	0.36
135	0.32
136	0.29
137	0.24
138	0.17
139	0.1
140	0.08
141	0.1
142	0.1
143	0.11
144	0.1
145	0.1
146	0.11
147	0.11
148	0.1
149	0.08
150	0.08
151	0.09
152	0.09
153	0.09
154	0.08
155	0.08
156	0.08
157	0.07
158	0.11
159	0.09
160	0.11
161	0.11
162	0.12
163	0.12
164	0.13
165	0.14
166	0.11
167	0.14
168	0.13
169	0.16
170	0.17
171	0.21
172	0.23
173	0.24
174	0.24
175	0.22
176	0.23
177	0.24
178	0.26
179	0.28
180	0.26
181	0.25
182	0.24
183	0.26
184	0.29
185	0.27
186	0.24
187	0.18
188	0.18
189	0.17
190	0.2
191	0.19
192	0.15
193	0.12
194	0.15
195	0.15
196	0.14
197	0.14
198	0.11
199	0.09
200	0.09
201	0.09
202	0.06
203	0.06
204	0.06
205	0.06
206	0.07
207	0.07
208	0.07
209	0.09
210	0.1
211	0.11
212	0.11
213	0.11
214	0.09
215	0.1
216	0.11
217	0.1
218	0.09
219	0.08
220	0.15
221	0.15
222	0.15
223	0.15
224	0.14
225	0.15
226	0.15
227	0.16
228	0.09
229	0.1
230	0.1
231	0.09
232	0.09
233	0.08
234	0.08
235	0.08
236	0.11
237	0.1
238	0.1
239	0.1
240	0.12
241	0.16
242	0.17
243	0.16
244	0.13
245	0.14
246	0.14
247	0.15
248	0.14
249	0.1
250	0.1
251	0.11
252	0.11
253	0.09
254	0.1
255	0.09
256	0.08
257	0.08
258	0.07
259	0.06
260	0.05
261	0.08
262	0.07
263	0.06
264	0.06
265	0.07
266	0.09
267	0.09
268	0.11
269	0.08
270	0.09
271	0.13
272	0.14
273	0.18
274	0.16
275	0.17
276	0.15
277	0.15
278	0.19
279	0.19
280	0.22
281	0.2
282	0.22
283	0.23
284	0.24
285	0.25
286	0.24
287	0.21
288	0.17
289	0.17
290	0.15
291	0.14
292	0.13
293	0.13
294	0.1
295	0.11
296	0.1
297	0.09
298	0.1
299	0.1
300	0.12
301	0.11
302	0.11
303	0.13
304	0.15
305	0.17
306	0.19
307	0.2
308	0.19
309	0.19
310	0.21
311	0.18
312	0.16
313	0.15
314	0.13
315	0.12
316	0.12
317	0.13
318	0.12
319	0.12
320	0.11
321	0.09
322	0.09
323	0.1
324	0.09
325	0.07
326	0.1
327	0.12
328	0.16
329	0.2
330	0.25
331	0.32
332	0.35
333	0.39
334	0.41
335	0.42
336	0.44
337	0.51
338	0.5
339	0.45
340	0.44
341	0.41
342	0.36
343	0.33
344	0.29
345	0.2
346	0.19
347	0.17
348	0.17
349	0.18
350	0.18
351	0.22
352	0.27
353	0.32
354	0.39
355	0.49
356	0.52
357	0.6
358	0.67
359	0.7
360	0.74
361	0.78
362	0.79
363	0.8
364	0.83
365	0.84
366	0.87
367	0.83
368	0.82
369	0.82
370	0.81
371	0.8
372	0.76
373	0.68
374	0.59
375	0.54
376	0.46
377	0.37
378	0.33
379	0.23
380	0.19
381	0.17
382	0.15
383	0.16
384	0.18
385	0.18
386	0.12
387	0.13
388	0.17
389	0.19
390	0.25
391	0.26
392	0.27
393	0.26
394	0.25
395	0.26
396	0.24
397	0.25
398	0.2
399	0.26
400	0.23
401	0.26
402	0.26
403	0.24
404	0.25
405	0.22
406	0.21
407	0.16
408	0.16
409	0.14
410	0.14
411	0.19
412	0.17
413	0.19
414	0.19
415	0.21
416	0.21
417	0.27
418	0.36

A0A0F4Z6G1

3D AlphaFold-predicted Structure Viewer